• Gene id: 151

Gene Summary

• Gene Symbol: ADRA2B   Gene   UCSC   Ensembl
• Aliases: ADRA2L1, ADRA2RL1, ADRARL1, ALPHA2BAR, FAME2, alpha-2BAR
• Gene name: adrenoceptor alpha 2B
• Alternate names: alpha-2B adrenergic receptor, ADRA2B adrenergic, alpha-2B-, receptor, G-protein coupled receptor, alpha-2 adrenergic receptor subtype C2, alpha-2-adrenergic receptor-like 1, alpha-2B adrenoreceptor,
• Gene location: 2q11.2 (96116570: 96112875)     Exons: 1     NC_000002.12
• Gene summary(Entrez): This intronless gene encodes a seven-pass transmembrane protein. This protein is a member of a subfamily of G protein-coupled receptors that regulate neurotransmitter release from sympathetic nerves and from adrenergic neurons in the central nervous syste
• OMIM: 608085

SNPs

rs13017562

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000002.12   g.28492063G>A
NC_000002.12   g.28492063G>C
NC_000002.11   g.28714930G>A
NC_000002.11   g.28714930G>C
NG_051297.1   g.8485G>A
NG_051297.1   g.8485G>C|SEQ=[G/A/C]|GENE=PLB1

rs2855658

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000002.12   g.38069747T>C
NC_000002.11   g.38296890T>C
NG_008386.2   g.11355A>G
NM_000104.3   c.*975A>G|SEQ=[T/C]|GENE=CYP1B1
RMDN2   151393

Protein Summary

• Protein general information: P18089  
  • Name: Alpha 2B adrenergic receptor (Alpha 2 adrenergic receptor subtype C2) (Alpha 2B adrenoreceptor) (Alpha 2B adrenoceptor) (Alpha 2BAR)
  • Length: 450  
  • Mass: 49954
• Sequence:

  MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANELL
  GYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKCIILTVWLIAAVISLPPLIY
  KGDQGPQPRGRPQCKLNQEAWYILASSIGSFFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDH
  GGALASAKLPALASVASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEE
  EEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRRAQLTREKRFTFVLAV
  VIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSSLNPVIYTIFNQDFRRAFRRILCRPWTQTAW

• Structural information:
  • Interpro: IPR002233  IPR000207  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • PDB: 2CVA
  • PDBsum: 2CVA
  • DIP: 61453
  • STRING: ENSP00000480573
• Other Databases: GeneCards:  ADRA2B  Malacards:  ADRA2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071880	adenylate cyclase-activating adrenergic receptor signaling pathway	IBA	biological process
GO:0051379	epinephrine binding	IBA	molecular function
GO:0007267	cell-cell signaling	IBA	biological process
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0004938	alpha2-adrenergic receptor activity	IBA	molecular function
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004935	adrenergic receptor activity	IEA	molecular function
GO:0006940	regulation of smooth muscle contraction	IEA	biological process
GO:0030168	platelet activation	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004938	alpha2-adrenergic receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019229	regulation of vasoconstriction	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004938	alpha2-adrenergic receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007267	cell-cell signaling	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070474	positive regulation of uterine smooth muscle contraction	IEA	biological process
GO:0004938	alpha2-adrenergic receptor activity	IEA	molecular function
GO:0045777	positive regulation of blood pressure	IEA	biological process
GO:0007565	female pregnancy	IEA	biological process
GO:0003056	regulation of vascular smooth muscle contraction	IEA	biological process
GO:0000187	activation of MAPK activity	IEA	biological process
GO:0035624	receptor transactivation	IDA	biological process
GO:0051379	epinephrine binding	IDA	molecular function
GO:0004938	alpha2-adrenergic receptor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045666	positive regulation of neuron differentiation	IDA	biological process
GO:0010700	negative regulation of norepinephrine secretion	NAS	biological process
GO:0010700	negative regulation of norepinephrine secretion	TAS	biological process
GO:0071875	adrenergic receptor signaling pathway	IDA	biological process
GO:0032148	activation of protein kinase B activity	IDA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IDA	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0032811	negative regulation of epinephrine secretion	NAS	biological process
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04022	cGMP-PKG signaling pathway

Diseases

Associated diseases	References
Familial adult myoclonic epilepsy	KEGG:H02213
Familial adult myoclonic epilepsy	KEGG:H02213
Hypertension	PMID:18953403
Myocardial infarction	PMID:12535806
type 2 diabetes mellitus	PMID:17277585
type 2 diabetes mellitus	PMID:17039423
Diabetic neuropathy	PMID:17516297
obesity	PMID:10404816
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881