About Us

Search Result


Gene id 150786
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol RAB6D   Gene   UCSC   Ensembl
Aliases RAB6CL, WTH3DI
Gene name RAB6D, member RAS oncogene family
Alternate names ras-related protein Rab-6D, RAB6C-like, rab6-like protein WTH3DI,
Gene location 2q21.1 (131364167: 131360491)     Exons: 1     NC_000002.12
OMIM 0

Protein Summary

Protein general information Q53S08  

Name: Ras related protein Rab 6D (Rab6 like protein WTH3DI)

Length: 254  Mass: 28242

Sequence MSAGGDFGNPLRKFKLVFLGEQSVAKTSLITRFRYDSFDNTYQAIIGIDFLSKTMYLEDGTIGLRLWDTAGQERL
RSLIPRYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTEGGSDVIITLVGNKTDLADKRQVSIEEGERKAKGLNV
TFIETRAKAGYNVKQLFRRVAAALPGMESTQDGSREDMSDIKLEKPQEQTVSEGGCSCYSPMSSSTLPQKPPYSF
IDCSVNIGLNLFPSLITFCNSSLLPVSWR
Structural information
Interpro:  IPR027417  IPR005225  IPR001806  
Prosite:   PS51419
Other Databases GeneCards:  RAB6D  Malacards:  RAB6D

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0032482 Rab protein signal transd
uction
IBA biological process
GO:0012505 endomembrane system
IBA cellular component
GO:0006891 intra-Golgi vesicle-media
ted transport
IBA biological process
GO:0005794 Golgi apparatus
IBA cellular component
GO:0003924 GTPase activity
IBA molecular function
GO:0042147 retrograde transport, end
osome to Golgi
IBA biological process
GO:0006890 retrograde vesicle-mediat
ed transport, Golgi to en
doplasmic reticulum
IBA biological process
GO:0006886 intracellular protein tra
nsport
IBA biological process
GO:0003924 GTPase activity
IEA molecular function
GO:0005525 GTP binding
IEA molecular function
GO:0005525 GTP binding
IEA molecular function
GO:0000166 nucleotide binding
IEA molecular function
GO:0005794 Golgi apparatus
IDA cellular component
GO:0005829 cytosol
IEA cellular component
Associated diseases References
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract