• Gene id: 150786

Gene Summary

• Gene Symbol: RAB6D   Gene   UCSC   Ensembl
• Aliases: RAB6CL, WTH3DI
• Gene name: RAB6D, member RAS oncogene family
• Alternate names: ras-related protein Rab-6D, RAB6C-like, rab6-like protein WTH3DI,
• Gene location: 2q21.1 (131364167: 131360491)     Exons: 1     NC_000002.12
• OMIM: 0

Protein Summary

• Protein general information: Q53S08  
  • Name: Ras related protein Rab 6D (Rab6 like protein WTH3DI)
  • Length: 254  
  • Mass: 28242
• Sequence:

  MSAGGDFGNPLRKFKLVFLGEQSVAKTSLITRFRYDSFDNTYQAIIGIDFLSKTMYLEDGTIGLRLWDTAGQERL
  RSLIPRYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTEGGSDVIITLVGNKTDLADKRQVSIEEGERKAKGLNV
  TFIETRAKAGYNVKQLFRRVAAALPGMESTQDGSREDMSDIKLEKPQEQTVSEGGCSCYSPMSSSTLPQKPPYSF
  IDCSVNIGLNLFPSLITFCNSSLLPVSWR

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR001806  
  • Prosite: PS51419
• Other Databases: GeneCards:  RAB6D  Malacards:  RAB6D

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032482	Rab protein signal transduction	IBA	biological process
GO:0012505	endomembrane system	IBA	cellular component
GO:0006891	intra-Golgi vesicle-mediated transport	IBA	biological process
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0003924	GTPase activity	IBA	molecular function
GO:0042147	retrograde transport, endosome to Golgi	IBA	biological process
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IBA	biological process
GO:0006886	intracellular protein transport	IBA	biological process
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)