• Gene id: 150696

Gene Summary

• Gene Symbol: PROM2   Gene   UCSC   Ensembl
• Aliases: PROML2
• Gene name: prominin 2
• Alternate names: prominin-2, prominin-like protein 2, prominin-related protein,
• Gene location: 2q11.1 (95274448: 95291319)     Exons: 25     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of the prominin family of pentaspan membrane glycoproteins. The encoded protein localizes to basal epithelial cells and may be involved in the organization of plasma membrane microdomains. Alternative splicing results in multipl
• OMIM: 609108

Protein Summary

• Protein general information: Q8N271  
  • Name: Prominin 2 (PROM 2) (Prominin like protein 2) (hPROML2)
  • Length: 834  
  • Mass: 91883
  • Tissue specificity: Present in saliva within small membrane particles (at protein level). Expressed in kidney, prostate, trachea, esophagus, salivary gland, thyroid gland, mammary gland adrenal gland, placenta, stomach, spinal cord and liver. In submucosa
• Sequence:

  MKHTLALLAPLLGLGLGLALSQLAAGATDCKFLGPAEHLTFTPAARARWLAPRVRAPGLLDSLYGTVRRFLSVVQ
  LNPFPSELVKALLNELASVKVNEVVRYEAGYVVCAVIAGLYLLLVPTAGLCFCCCRCHRRCGGRVKTEHKALACE
  RAALMVFLLLTTLLLLIGVVCAFVTNQRTHEQMGPSIEAMPETLLSLWGLVSDVPQELQAVAQQFSLPQEQVSEE
  LDGVGVSIGSAIHTQLRSSVYPLLAAVGSLGQVLQVSVHHLQTLNATVVELQAGQQDLEPAIREHRDRLLELLQE
  ARCQGDCAGALSWARTLELGADFSQVPSVDHVLHQLKGVPEANFSSMVQEENSTFNALPALAAMQTSSVVQELKK
  AVAQQPEGVRTLAEGFPGLEAASRWAQALQEVEESSRPYLQEVQRYETYRWIVGCVLCSVVLFVVLCNLLGLNLG
  IWGLSARDDPSHPEAKGEAGARFLMAGVGLSFLFAAPLILLVFATFLVGGNVQTLVCQSWENGELFEFADTPGNL
  PPSMNLSQLLGLRKNISIHQAYQQCKEGAALWTVLQLNDSYDLEEHLDINQYTNKLRQELQSLKVDTQSLDLLSS
  AARRDLEALQSSGLQRIHYPDFLVQIQRPVVKTSMEQLAQELQGLAQAQDNSVLGQRLQEEAQGLRNLHQEKVVP
  QQSLVAKLNLSVRALESSAPNLQLETSDVLANVTYLKGELPAWAARILRNVSECFLAREMGYFSQYVAWVREEVT
  QRIATCQPLSGALDNSRVILCDMMADPWNAFWFCLAWCTFFLIPSIIFAVKTSKYFRPIRKRLSSTSSEETQLFH
  IPRVTSLKL

• Structural information:
  • Interpro: IPR008795  
  • STRING: ENSP00000318270
• Other Databases: GeneCards:  PROM2  Malacards:  PROM2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005902	microvillus	IBA	cellular component
GO:0071914	prominosome	IBA	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0005929	cilium	IBA	cellular component
GO:0009986	cell surface	IBA	cellular component
GO:0015485	cholesterol binding	IBA	molecular function
GO:0016324	apical plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071914	prominosome	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0031528	microvillus membrane	IEA	cellular component
GO:0060170	ciliary membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0043087	regulation of GTPase activity	IDA	biological process
GO:2001287	negative regulation of caveolin-mediated endocytosis	IDA	biological process
GO:0048550	negative regulation of pinocytosis	IDA	biological process
GO:0031346	positive regulation of cell projection organization	IDA	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:2000369	regulation of clathrin-dependent endocytosis	IDA	NOT|biological process
GO:0042995	cell projection	IDA	cellular component
GO:0015485	cholesterol binding	ISS	molecular function
GO:0071914	prominosome	ISS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0045121	membrane raft	ISS	colocalizes with
GO:0031410	cytoplasmic vesicle	ISS	cellular component
GO:0009986	cell surface	ISS	cellular component
GO:0005929	cilium	ISS	cellular component
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0044393	microspike	ISS	cellular component
GO:0005902	microvillus	ISS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq