• Gene id: 150678

Gene Summary

• Gene Symbol: COPS9   Gene   UCSC   Ensembl
• Aliases: CSNAP, MYEOV2
• Gene name: COP9 signalosome subunit 9
• Alternate names: COP9 signalosome complex subunit 9, CSN acidic protein, helicase/primase complex protein, myeloma overexpressed 2, myeloma-overexpressed gene 2 protein,
• Gene location: 2q37.3 (240136801: 240126547)     Exons: 30     NC_000002.12

Protein Summary

• Protein general information: Q8WXC6  
  • Name: COP9 signalosome complex subunit 9 (CSN acidic protein) (CSNAP) (Myeloma overexpressed gene 2 protein)
  • Length: 57  
  • Mass: 6211
• Sequence:

  MKPAVDEMFPEGAGPYVDLDEAGGSTGLLMDLAANEKAVHADFFNDFEDLFDDDDIQ

• Structural information:
  • Interpro: IPR029391  
• Other Databases: GeneCards:  COPS9  Malacards:  COPS9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008180	COP9 signalosome	IBA	colocalizes with
GO:2000435	negative regulation of protein neddylation	IBA	biological process
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0008180	COP9 signalosome	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0034644	cellular response to UV	IDA	biological process
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008180	COP9 signalosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq