• Gene id: 150483

Gene Summary

• Gene Symbol: TEKT4   Gene   UCSC   Ensembl
• Gene name: tektin 4
• Alternate names: tektin-4,
• Gene location: 2q11.1 (94871432: 94876828)     Exons: 6     NC_000002.12
• OMIM: 0

Protein Summary

• Protein general information: Q8WW24  
  • Name: Tektin 4
  • Length: 435  
  • Mass: 50,649
• Sequence:

  MAQTVPPCELPCKEYDVARNTGAYTSSGLATASFRTSKYLLEEWFQNCYARYHQAFADRDQSERQRHESQQLATE
  TQALAQRTQQDSTRTVGERLQDTHSWKSELQREMEALAAETNLLLAQKQRLERALDATEVPFSITTDNLQCRERR
  EHPNLVRDHVETELLKEAELIRNIQELLKRTIMQAVSQIRLNREHKETCEMDWSDKMEAYNIDETCGRHHSQSTE
  VQAHPYSTTFQESASTPETRAKFTQDNLCRAQRERLASANLRVLVDCILRDTSEDLRLQCDAVNLAFGRRCEELE
  DARYKLHHHLHKTLREITDQEHNVAALKQAIKDKEAPLHVAQTRLYLRSHRPNMELCRDAAQFRLLSEVEELNMS
  LTALREKLLEAEQSLRNLEDIHMSLEKDIAAMTNSLFIDRQKCMAHRTRYPTILQLAGYQ

• Structural information:
  • Interpro: IPR000435  
  • STRING: ENSP00000295201
• Other Databases: GeneCards:  TEKT4  Malacards:  TEKT4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0030030	cell projection organization	IEA	biological process
GO:0031514	motile cilium	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0030030	cell projection organization	IEA	biological process
GO:0031514	motile cilium	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component

Diseases

Associated diseases	References
Asthenozoospermia	MIK: 22774605
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Idiopathic asthenozoospermia	MIK: 22774605
Necessary for proper coordinated beating of the sperm flagellum and male reproductive physiology	MIK: 17244819

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
22774605	Idiopathic asthenozoospermia				Male infertility	TEKT4
17244819	Necessary for proper coordinated beating of the sperm flagellum and male reproductive physiology				Male infertility
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq