• Gene id: 1504

Gene Summary

• Gene Symbol: CTRB1   Gene   UCSC   Ensembl
• Aliases: CTRB
• Gene name: chymotrypsinogen B1
• Alternate names: chymotrypsinogen B,
• Gene location: 16q23.1 (75218987: 75224923)     Exons: 7     NC_000016.10
• Gene summary(Entrez): This gene encodes a member of the serine protease family of enzymes and forms a principal precursor of the pancreatic proteolytic enzymes. The encoded preproprotein is synthesized in the acinar cells of the pancreas and secreted into the small intestine w
• OMIM: 610147

Protein Summary

• Protein general information: P17538  
  • Name: Chymotrypsinogen B (EC 3.4.21.1) [Cleaved into: Chymotrypsin B chain A; Chymotrypsin B chain B; Chymotrypsin B chain C]
  • Length: 263  
  • Mass: 27713
• Sequence:

  MASLWLLSCFSLVGAAFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAH
  CGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPA
  GTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMICAGASGVSSCMGDSGGPLVCQKDGAW
  TLVGIVSWGSDTCSTSSPGVYARVTKLIPWVQKILAAN

• Structural information:
  • Protein Domains: (34..26-)
    (/note="Peptidase-S1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00274"-)
  • Interpro: IPR009003  IPR001314  IPR001254  IPR018114  IPR033116  
  • Prosite: PS50240 PS00134 PS00135
  • CDD: cd00190
  • STRING: ENSP00000354294
• Other Databases: GeneCards:  CTRB1  Malacards:  CTRB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006508	proteolysis	IBA	biological process
GO:0004252	serine-type endopeptidase activity	IBA	molecular function
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0007586	digestion	IEA	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0009235	cobalamin metabolic process	TAS	biological process
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0004252	serine-type endopeptidase activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04974	Protein digestion and absorption
hsa04972	Pancreatic secretion

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq