• Gene id: 150290

Gene Summary

• Gene Symbol: DUSP18   Gene   UCSC   Ensembl
• Aliases: DSP18, DUSP20, LMWDSP20
• Gene name: dual specificity phosphatase 18
• Alternate names: dual specificity protein phosphatase 18, low molecular weight dual specificity phosphatase 20,
• Gene location: 22q12.2 (30667886: 30652050)     Exons: 6     NC_000022.11
• Gene summary(Entrez): Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues.
• OMIM: 610480

Protein Summary

• Protein general information: Q8NEJ0  
  • Name: Dual specificity protein phosphatase 18 (EC 3.1.3.16) (EC 3.1.3.48) (Low molecular weight dual specificity phosphatase 20) (LMW DSP20)
  • Length: 188  
  • Mass: 21066
  • Tissue specificity: Widely expressed with highest levels in liver, brain, ovary and testis. {ECO
• Sequence:

  MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTLYEDIQYMQVPVADSP
  NSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLMKYHAMSLLDAHTWTKSCRPIIRPNSGFWEQ
  LIHYEFQLFGKNTVHMVSSPVGMIPDIYEKEVRLMIPL

• Structural information:
  • Protein Domains: (80..14-)
    (/note="Tyrosine-protein-phosphatase")
  • Interpro: IPR020417  IPR020420  IPR000340  IPR029021  IPR016130   IPR000387  IPR020422  
  • Prosite: PS00383 PS50056 PS50054
  • PDB: 2ESB
  • PDBsum: 2ESB
  • STRING: ENSP00000333917
• Other Databases: GeneCards:  DUSP18  Malacards:  DUSP18

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016311	dephosphorylation	IDA	biological process
GO:0016791	phosphatase activity	IDA	molecular function
GO:0035970	peptidyl-threonine dephosphorylation	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0000188	inactivation of MAPK activity	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R