• Gene id: 150274

Gene Summary

• Gene Symbol: HSCB   Gene   UCSC   Ensembl
• Aliases: DNAJC20, HSC20, JAC1
• Gene name: HscB mitochondrial iron-sulfur cluster cochaperone
• Alternate names: iron-sulfur cluster co-chaperone protein HscB, DnaJ (Hsp40) homolog, subfamily C, member 20, HscB iron-sulfur cluster co-chaperone homolog, HscB mitochondrial iron-sulfur cluster co-chaperone, J-type co-chaperone HSC20, epididymis secretory sperm binding prote,
• Gene location: 22q12.1 (28741991: 28757509)     Exons: 7     NC_000022.11
• Gene summary(Entrez): This gene encodes a DnaJ-type co-chaperone and member of the heat shock cognate B (HscB) family of proteins. The encoded protein plays a role in the synthesis of iron-sulfur clusters, protein cofactors that are involved in the redox reactions of mitochond
• OMIM: 617340

Protein Summary

• Protein general information: Q8IWL3  
  • Name: Iron sulfur cluster co chaperone protein HscB (DnaJ homolog subfamily C member 20) [Cleaved into: Iron sulfur cluster co chaperone protein HscB, cytoplasmic (C HSC20); Iron sulfur cluster co chaperone protein HscB, mitochondrial]
  • Length: 235  
  • Mass: 27422
  • Tissue specificity: Expressed in lung, brain, stomach, spleen, ovary, testis, liver, muscle and heart. {ECO
• Sequence:

  MWRGRAGALLRVWGFWPTGVPRRRPLSCDAASQAGSNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFS
  LMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIP
  ERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIE
  EKIKLKKIPL

• Structural information:
  • Protein Domains: (72..14-)
    (/note="J"-)
  • Interpro: IPR001623  IPR004640  IPR040682  IPR036386  IPR009073   IPR036869  
  • CDD: cd06257
  • PDB: 3BVO
  • PDBsum: 3BVO
  • DIP: 46570
  • STRING: ENSP00000216027
• Other Databases: GeneCards:  HSCB  Malacards:  HSCB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003674	molecular_function	ND	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0044571	[2Fe-2S] cluster assembly	IBA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0016226	iron-sulfur cluster assembly	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051259	protein complex oligomerization	IEA	biological process
GO:0097428	protein maturation by iron-sulfur cluster transfer	IEA	biological process
GO:0001671	ATPase activator activity	IEA	molecular function
GO:0051087	chaperone binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	TAS	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0032781	positive regulation of ATPase activity	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq