• Gene id: 150

Gene Summary

• Gene Symbol: ADRA2A   Gene   UCSC   Ensembl
• Aliases: ADRA2, ADRA2R, ADRAR, ALPHA2AAR, ZNF32
• Gene name: adrenoceptor alpha 2A
• Alternate names: alpha-2A adrenergic receptor, adrenergic, alpha-2A-, receptor, alpha-2 adrenergic receptor subtype C10, alpha-2-adrenergic receptor, platelet type, alpha-2A adrenoceptor, alpha-2A adrenoreceptor, alpha-2AAR subtype C10,
• Gene location: 10q25.2 (111077028: 111080906)     Exons: 1     NC_000010.11
• Gene summary(Entrez): Alpha-2-adrenergic receptors are members of the G protein-coupled receptor superfamily. The alpha-2-adrenergic receptors are a type of adrenergic receptors (for adrenaline or epinephrine), which inhibit adenylate cyclase. These receptors include 3 highly
• OMIM: 104210

SNPs

rs718772

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000022.11   g.30108218A>C
NC_000022.11   g.30108218A>G
NC_000022.10   g.30504207A>C
NC_000022.10   g.30504207A>G|SEQ=[A/C/G]|GENE=HORMAD2

rs8135823

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000022.11   g.30126470T>G
NC_000022.10   g.30522459T>G|SEQ=[T/G]|GENE=HORMAD2

rs11090601

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000022.11   g.30171741A>C
NC_000022.10   g.30567730A>C|SEQ=[A/C]|GENE=HORMAD2

rs4823073

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000022.11   g.30116269G>A
NC_000022.10   g.30512258G>A|SEQ=[G/A]|GENE=HORMAD2

rs9620953

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000022.11   g.30150256C>T
NC_000022.10   g.30546245C>T|SEQ=[C/T]|GENE=HORMAD2

rs9625930

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000022.11   g.30152633G>A
NC_000022.10   g.30548622G>A|SEQ=[G/A]|GENE=HORMAD2

rs975704

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000022.11   g.30176747G>A
NC_000022.10   g.30572736G>A
NM_152510.3   c.*580G>A
NM_152510.4   c.*580G>A
NM_152510.2   c.*580G>A
XM_011529917.3   c.*580G>A
NM_001329457.1   c.*580G>A
NM_001329457.2   c.*580G>A
NM_001329458.1   c.*580G>A
NM_001329458.2   c.*580G>A|SEQ=[

Protein Summary

• Protein general information: P08913  
  • Name: Alpha 2A adrenergic receptor (Alpha 2 adrenergic receptor subtype C10) (Alpha 2A adrenoreceptor) (Alpha 2A adrenoceptor) (Alpha 2AAR)
  • Length: 465  
  • Mass: 50647
• Sequence:

  MFRQEQPLAEGSFAPMGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLLTVFGNVLVIIAVFT
  SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSSIVHLCAISLDRYWSI
  TQAIEYNLKRTPRRIKAIIITVWVISAVISFPPLISIEKKGGGGGPQPAEPRCEINDQKWYVISSCIGSFFAPCL
  IMILVYVRIYQIAKRRTRVPPSRRGPDAVAAPPGGTERRPNGLGPERSAGPGGAEAEPLPTQLNGAPGEPAPAGP
  RDTDALDLEESSSSDHAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGATGIGTPAAGPGEERVGAAKAS
  RWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPRTLFKFFFWFGYCNSSLNPVIYTIFNHDFRR
  AFKKILCRGDRKRIV

• Structural information:
  • Interpro: IPR002233  IPR001946  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • PDB: 1HLL 1HO9 1HOD 1HOF
  • PDBsum: 1HLL 1HO9 1HOD 1HOF
  • DIP: 61452
  • STRING: ENSP00000280155
• Other Databases: GeneCards:  ADRA2A  Malacards:  ADRA2A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0004938	alpha2-adrenergic receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0007267	cell-cell signaling	IBA	biological process
GO:0051379	epinephrine binding	IBA	molecular function
GO:0071880	adenylate cyclase-activating adrenergic receptor signaling pathway	IBA	biological process
GO:0004935	adrenergic receptor activity	IEA	molecular function
GO:0006940	regulation of smooth muscle contraction	IEA	biological process
GO:0030168	platelet activation	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004938	alpha2-adrenergic receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019229	regulation of vasoconstriction	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007265	Ras protein signal transduction	TAS	biological process
GO:0007266	Rho protein signal transduction	TAS	biological process
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0030036	actin cytoskeleton organization	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0050796	regulation of insulin secretion	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IDA	biological process
GO:0035624	receptor transactivation	IDA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS	biological process
GO:0032795	heterotrimeric G-protein binding	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0051379	epinephrine binding	IDA	molecular function
GO:0051379	epinephrine binding	IDA	molecular function
GO:0051380	norepinephrine binding	IDA	molecular function
GO:0031692	alpha-1B adrenergic receptor binding	ISS	molecular function
GO:0031696	alpha-2C adrenergic receptor binding	IPI	molecular function
GO:0004938	alpha2-adrenergic receptor activity	IDA	molecular function
GO:0004938	alpha2-adrenergic receptor activity	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0031996	thioesterase binding	IPI	molecular function
GO:0046982	protein heterodimerization activity	ISS	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0001819	positive regulation of cytokine production	IDA	biological process
GO:0043235	receptor complex	IDA	cellular component
GO:0043406	positive regulation of MAP kinase activity	IDA	biological process
GO:0045955	negative regulation of calcium ion-dependent exocytosis	IC	biological process
GO:0010700	negative regulation of norepinephrine secretion	NAS	biological process
GO:0010700	negative regulation of norepinephrine secretion	TAS	biological process
GO:0016323	basolateral plasma membrane	TAS	cellular component
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0042593	glucose homeostasis	IMP	biological process
GO:0046676	negative regulation of insulin secretion	IMP	biological process
GO:0050995	negative regulation of lipid catabolic process	IGI	biological process
GO:0051926	negative regulation of calcium ion transport	ISS	biological process
GO:0071880	adenylate cyclase-activating adrenergic receptor signaling pathway	ISS	biological process
GO:0090303	positive regulation of wound healing	IMP	biological process
GO:0035624	receptor transactivation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0032147	activation of protein kinase activity	IDA	biological process
GO:0032148	activation of protein kinase B activity	IDA	biological process
GO:0045741	positive regulation of epidermal growth factor-activated receptor activity	IDA	biological process
GO:0051044	positive regulation of membrane protein ectodomain proteolysis	IDA	biological process
GO:0071881	adenylate cyclase-inhibiting adrenergic receptor signaling pathway	IDA	biological process
GO:0071882	phospholipase C-activating adrenergic receptor signaling pathway	IDA	biological process
GO:0071875	adrenergic receptor signaling pathway	IDA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IDA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	ISS	biological process
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	ISS	biological process
GO:0032811	negative regulation of epinephrine secretion	NAS	biological process
GO:0032870	cellular response to hormone stimulus	IGI	biological process
GO:0043268	positive regulation of potassium ion transport	ISS	biological process
GO:0050892	intestinal absorption	TAS	biological process
GO:0061179	negative regulation of insulin secretion involved in cellular response to glucose stimulus	IMP	biological process
GO:1901020	negative regulation of calcium ion transmembrane transporter activity	ISS	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04022	cGMP-PKG signaling pathway

Diseases

Associated diseases	References
Attention deficit hyperactivity disorder	PMID:16178932
type 2 diabetes mellitus	PMID:19965390
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881