• Gene id: 149708

Gene Summary

• Gene Symbol: WFDC5   Gene   UCSC   Ensembl
• Aliases: PRG5, WAP1, dJ211D12.5
• Gene name: WAP four-disulfide core domain 5
• Alternate names: WAP four-disulfide core domain protein 5, p53-responsive gene 5 protein, protease inhibitor WAP1, putative protease inhibitor WAP1,
• Gene location: 20q13.12 (45116320: 45109458)     Exons: 6     NC_000020.11
• Gene summary(Entrez): This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. Most WFDC proteins contain only one WFDC domain, and this encoded protein contains two WFDC domains. The WFDC domain, or WAP signature motif, contains eight cysteines for
• OMIM: 610179

Protein Summary

• Protein general information: Q8TCV5  
  • Name: WAP four disulfide core domain protein 5 (Putative protease inhibitor WAP1) (p53 responsive gene 5 protein)
  • Length: 224  
  • Mass: 24238
• Sequence:

  MRTQSLLLLGALLAVGSQLPAVFGRKKGEKSGGCPPDDGPCLLSVPDQCVEDSQCPLTRKCCYRACFRQCVPRVS
  VKLGSCPEDQLRCLSPMNHLCHKDSDCSGKKRCCHSACGRDCRDPARGTAPGCPGQANSDLGSVALHLSWGPTER
  VHDGRPGALPAGQHYLYQRWFQPSDNHWPADTSLQPIHPWFLLLGVKVHSLSSEEGLCITPVLCTTAIRASHPS

• Structural information:
  • Protein Domains: (27..7-)
    (/note="WAP-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00722-)
    (74..12-)
    (/note="WAP-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00722"-)
  • Interpro: IPR036645  IPR008197  IPR029714  
  • Prosite: PS51390
  • STRING: ENSP00000361875
• Other Databases: GeneCards:  WFDC5  Malacards:  WFDC5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0019731	antibacterial humoral response	IBA	biological process
GO:0045087	innate immune response	IBA	biological process
GO:0004867	serine-type endopeptidase inhibitor activity	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq