• Gene id: 149603

Gene Summary

• Gene Symbol: RNF187   Gene   UCSC   Ensembl
• Aliases: RACO-1, RACO1
• Gene name: ring finger protein 187
• Alternate names: E3 ubiquitin-protein ligase RNF187, RING domain AP1 coactivator 1, RING-type E3 ubiquitin transferase RNF187, protein RNF187, ring domain AP-1 co-activator 1,
• Gene location: 1q42.13 (228487381: 228496187)     Exons: 4     NC_000001.11
• OMIM: 613754

Protein Summary

• Protein general information: Q5TA31  
  • Name: E3 ubiquitin protein ligase RNF187 (EC 2.3.2.27) (RING domain AP1 coactivator 1) (RACO 1) (RING finger protein 187) (RING type E3 ubiquitin transferase RNF187)
  • Length: 235  
  • Mass: 26190
• Sequence:

  MALPAGPAEAACALCQRAPREPVRADCGHRFCRACVVRFWAEEDGPFPCPECADDCWQRAVEPGRPPLSRRLLAL
  EEAAAAPARDGPASEAALQLLCRADAGPLCAACRMAAGPEPPEWEPRWRKALRGKENKGSVEIMRKDLNDARDLH
  GQAESAAAVWKGHVMDRRKKALTDYKKLRAFFVEEEEHFLQEAEKEEGLPEDELADPTERFRSLLQAVSELEKKH
  RNLGLSMLLQ

• Structural information:
  • Interpro: IPR018957  IPR001841  IPR013083  IPR017907  
  • Prosite: PS00518 PS50089
  • STRING: ENSP00000306396
• Other Databases: GeneCards:  RNF187  Malacards:  RNF187

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045087	innate immune response	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0016567	protein ubiquitination	IBA	biological process
GO:0016604	nuclear body	IBA	cellular component
GO:0051091	positive regulation of DNA-binding transcription factor activity	IBA	biological process
GO:0008284	positive regulation of cell population proliferation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0051865	protein autoubiquitination	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0070936	protein K48-linked ubiquitination	IMP	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray