• Gene id: 1496

Gene Summary

• Gene Symbol: CTNNA2   Gene   UCSC   Ensembl
• Aliases: CAP-R, CAPR, CDCBM9, CT114, CTNR
• Gene name: catenin alpha 2
• Alternate names: catenin alpha-2, alpha-N-catenin, alpha-catenin-related protein, cadherin-associated protein, related, cancer/testis antigen 114, catenin (cadherin-associated protein), alpha 2,
• Gene location: 2p12 (79505053: 80648867)     Exons: 29     NC_000002.12
• OMIM: 114025

Protein Summary

• Protein general information: P26232  
  • Name: Catenin alpha 2 (Alpha N catenin) (Alpha catenin related protein)
  • Length: 953  
  • Mass: 105313
  • Tissue specificity: Expressed in neural tissues, with strongest expression in fetal and adult brain. Expressed in the developing cortical plate and marginal zone of 20-week-old human fetal brain. {ECO
• Sequence:

  MTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVLAASVEQATQNFLEKG
  EQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKRGTMVRAARALLSAVTRLLILADMADVMRLL
  SHLKIVEEALEAVKNATNEQDLANRFKEFGKEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQ
  AFLRHPDVAATRANRDYVFKQVQEAIAGISNAAQATSPTDEAKGHTGIGELAAALNEFDNKIILDPMTFSEARFR
  PSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMNNTGRKEKGDPLNIAIDKMTKKTRD
  LRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKEYAQVFREHANKLVEVANLACSISNNEEGVKLVRM
  AATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCV
  IALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENYEAGVYTEKVLEATKLLSETVMPRFAEQVEVAIEALSANV
  PQPFEENEFIDASRLVYDGVRDIRKAVLMIRTPEELEDDSDFEQEDYDVRSRTSVQTEDDQLIAGQSARAIMAQL
  PQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAE
  AGSRMDKLARAVADQCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELIVSGTGVQSTFTTFYEVDC
  DVIDGGRASQLSTHLPTCAEGAPIGSGSSDSSMLDSATSLIQAAKNLMNAVVLTVKASYVASTKYQKVYGTAAVN
  SPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHISPVQALSEFKAMDSF

• Structural information:
  • Interpro: IPR036723  IPR001033  IPR006077  IPR000633  
  • Prosite: PS00663
  • PDB: 6DUW
  • PDBsum: 6DUW
  • DIP: 60979
  • STRING: ENSP00000384638
• Other Databases: GeneCards:  CTNNA2  Malacards:  CTNNA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IDA	cellular component
GO:0051015	actin filament binding	IDA	molecular function
GO:0051823	regulation of synapse structural plasticity	ISS	biological process
GO:0048854	brain morphogenesis	ISS	biological process
GO:0048813	dendrite morphogenesis	ISS	biological process
GO:0030424	axon	ISS	cellular component
GO:0030424	axon	ISS	cellular component
GO:0098609	cell-cell adhesion	ISS	biological process
GO:0005912	adherens junction	ISS	cellular component
GO:0005912	adherens junction	ISS	cellular component
GO:0010975	regulation of neuron projection development	IMP	biological process
GO:0060134	prepulse inhibition	ISS	biological process
GO:0021942	radial glia guided migration of Purkinje cell	ISS	biological process
GO:0007409	axonogenesis	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0034316	negative regulation of Arp2/3 complex-mediated actin nucleation	IMP	biological process
GO:2001222	regulation of neuron migration	IMP	biological process
GO:0005198	structural molecule activity	IEA	molecular function
GO:0015629	actin cytoskeleton	IEA	cellular component
GO:0045296	cadherin binding	IEA	molecular function
GO:0051015	actin filament binding	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0051149	positive regulation of muscle cell differentiation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0099092	postsynaptic density, intracellular component	IEA	cellular component
GO:0098888	extrinsic component of presynaptic membrane	IEA	cellular component
GO:0098885	modification of postsynaptic actin cytoskeleton	IEA	biological process
GO:0098831	presynaptic active zone cytoplasmic component	IEA	cellular component
GO:0098688	parallel fiber to Purkinje cell synapse	IEA	cellular component
GO:0051823	regulation of synapse structural plasticity	IEA	biological process
GO:0048854	brain morphogenesis	IEA	biological process
GO:0048813	dendrite morphogenesis	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0005912	adherens junction	IEA	cellular component
GO:0098890	extrinsic component of postsynaptic membrane	IEA	cellular component
GO:0098686	hippocampal mossy fiber to CA3 synapse	IEA	cellular component
GO:0060134	prepulse inhibition	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0030027	lamellipodium	IEA	cellular component
GO:0021942	radial glia guided migration of Purkinje cell	IEA	biological process
GO:0014069	postsynaptic density	IEA	cellular component
GO:0007409	axonogenesis	IEA	biological process
GO:0045296	cadherin binding	HDA	molecular function
GO:0030424	axon	IEA	cellular component
GO:0005912	adherens junction	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0007010	cytoskeleton organization	IEA	biological process
GO:0005200	structural constituent of cytoskeleton	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04390	Hippo signaling pathway
hsa05226	Gastric cancer
hsa04670	Leukocyte transendothelial migration
hsa05412	Arrhythmogenic right ventricular cardiomyopathy
hsa05100	Bacterial invasion of epithelial cells
hsa04520	Adherens junction
hsa05213	Endometrial cancer

Diseases

Associated diseases	References
Complex cortical dysplasia with other brain malformations	KEGG:H01881
Complex cortical dysplasia with other brain malformations	KEGG:H01881
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray