• Gene id: 1495

Gene Summary

• Gene Symbol: CTNNA1   Gene   UCSC   Ensembl
• Aliases: CAP102, MDPT2
• Gene name: catenin alpha 1
• Alternate names: catenin alpha-1, alpha-E-catenin, catenin (cadherin-associated protein), alpha 1, 102kDa, epididymis secretory sperm binding protein, renal carcinoma antigen NY-REN-13,
• Gene location: 5q31.2 (138753385: 138935033)     Exons: 27     NC_000005.10
• Gene summary(Entrez): This gene encodes a member of the catenin family of proteins that play an important role in cell adhesion process by connecting cadherins located on the plasma membrane to the actin filaments inside the cell. The encoded mechanosensing protein contains th
• OMIM: 116805

Protein Summary

• Protein general information: P35221  
  • Name: Catenin alpha 1 (Alpha E catenin) (Cadherin associated protein) (Renal carcinoma antigen NY REN 13)
  • Length: 906  
  • Mass: 100071
  • Tissue specificity: Expressed ubiquitously in normal tissues.
• Sequence:

  MTAVHAGNINFKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSKGPSNKKRGRSKKAHVLAASVEQATENFLEK
  GDKIAKESQFLKEELVAAVEDVRKQGDLMKAAAGEFADDPCSSVKRGNMVRAARALLSAVTRLLILADMADVYKL
  LVQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAKRQQELKDVGHRDQMAAARGILQKNVPILYTAS
  QACLQHPDVAAYKANRDLIYKQLQQAVTGISNAAQATASDDASQHQGGGGGELAYALNNFDKQIIVDPLSFSEER
  FRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMGNAGRKERSDALNSAIDKMTKKT
  RDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYAQVFREHANKLIEVANLACSISNNEEGVKLV
  RMSASQLEALCPQVINAALALAAKPQSKLAQENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNK
  CVIALQEKDVDGLDRTAGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSS
  DPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTEDDQLIAGQSARAIMAQ
  LPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVISAAKKIA
  EAGSRMDKLGRTIADHCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNL
  MNAVVQTVKASYVASTKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEF
  KAMDSI

• Structural information:
  • Interpro: IPR036723  IPR001033  IPR006077  IPR000633  
  • Prosite: PS00663
  • PDB: 1H6G 4EHP 4IGG
  • PDBsum: 1H6G 4EHP 4IGG
  • DIP: 515
  • STRING: ENSP00000304669
• Other Databases: GeneCards:  CTNNA1  Malacards:  CTNNA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0016342	catenin complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005198	structural molecule activity	IEA	molecular function
GO:0015629	actin cytoskeleton	IEA	cellular component
GO:0045296	cadherin binding	IEA	molecular function
GO:0051015	actin filament binding	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007155	cell adhesion	NAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0034332	adherens junction organization	TAS	biological process
GO:0051149	positive regulation of muscle cell differentiation	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043627	response to estrogen	IEA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0005911	cell-cell junction	IEA	cellular component
GO:0001541	ovarian follicle development	IEA	biological process
GO:2001241	positive regulation of extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:2001045	negative regulation of integrin-mediated signaling pathway	IEA	biological process
GO:2000146	negative regulation of cell motility	IEA	biological process
GO:0051015	actin filament binding	IEA	molecular function
GO:0043297	apical junction assembly	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0042127	regulation of cell population proliferation	IEA	biological process
GO:0016600	flotillin complex	IEA	cellular component
GO:0014704	intercalated disc	IEA	cellular component
GO:0005915	zonula adherens	IEA	cellular component
GO:0005912	adherens junction	IEA	cellular component
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0042475	odontogenesis of dentin-containing tooth	IEA	biological process
GO:0031103	axon regeneration	IEA	biological process
GO:0016264	gap junction assembly	IEA	biological process
GO:0008584	male gonad development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0001669	acrosomal vesicle	IEA	cellular component
GO:2001240	negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:0090136	epithelial cell-cell adhesion	IEA	biological process
GO:0045880	positive regulation of smoothened signaling pathway	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0034613	cellular protein localization	IEA	biological process
GO:0030027	lamellipodium	IEA	cellular component
GO:0007406	negative regulation of neuroblast proliferation	IEA	biological process
GO:0007163	establishment or maintenance of cell polarity	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0008013	beta-catenin binding	IPI	molecular function
GO:0008013	beta-catenin binding	IPI	molecular function
GO:0045296	cadherin binding	IPI	molecular function
GO:0045295	gamma-catenin binding	IPI	molecular function
GO:0045295	gamma-catenin binding	IPI	molecular function
GO:0045296	cadherin binding	HDA	molecular function
GO:0005911	cell-cell junction	IDA	cellular component
GO:0016342	catenin complex	IDA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005912	adherens junction	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0030054	cell junction	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005911	cell-cell junction	IDA	cellular component
GO:0071681	cellular response to indole-3-methanol	IDA	biological process
GO:0005925	focal adhesion	HDA	cellular component
GO:0045296	cadherin binding	IPI	molecular function
GO:0045296	cadherin binding	IPI	molecular function
GO:0043297	apical junction assembly	NAS	biological process
GO:0017166	vinculin binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04390	Hippo signaling pathway
hsa05226	Gastric cancer
hsa04670	Leukocyte transendothelial migration
hsa05412	Arrhythmogenic right ventricular cardiomyopathy
hsa05100	Bacterial invasion of epithelial cells
hsa04520	Adherens junction
hsa05213	Endometrial cancer

Diseases

Associated diseases	References
Pattern dystrophies of the retinal pigment epithelium	KEGG:H01890
Prostate cancer	PMID:16334164
Prostate cancer	PMID:17639504
urinary bladder cancer	PMID:17760743
Transitional cell carcinoma	PMID:16426728
Invasive lobular carcinoma	PMID:12047765
renal cell carcinoma	PMID:9355975
cervix uteri carcinoma in situ	PMID:11161853
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq