• Gene id: 149233

Gene Summary

• Gene Symbol: IL23R   Gene   UCSC   Ensembl
• Gene name: interleukin 23 receptor
• Alternate names: interleukin-23 receptor, IL-23 receptor,
• Gene location: 1p31.3 (67138638: 67259978)     Exons: 13     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a subunit of the receptor for IL23A/IL23. This protein pairs with the receptor molecule IL12RB1/IL12Rbeta1, and both are required for IL23A signaling. This protein associates constitutively with Janus kinase 2 (JAK2), a
• OMIM: 607562

Protein Summary

• Protein general information: Q5VWK5  
  • Name: Interleukin 23 receptor (IL 23 receptor) (IL 23R)
  • Length: 629  
  • Mass: 71722
  • Tissue specificity: Expressed by monocytes, Th1, Th0, NK and dendritic cells. Isoform 1 is specifically expressed in NK cells. {ECO
• Sequence:

  MNQVTIQWDAVIALYILFSWCHGGITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIKERF
  QITRINKTTARLWYKNFLEPHASMYCTAECPKHFQETLICGKDISSGYPPDIPDEVTCVIYEYSGNMTCTWNAGK
  LTYIDTKYVVHVKSLETEEEQQYLTSSYINISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPSAAVI
  SRAETINATVPKTIIYWDSQTTIEKVSCEMRYKATTNQTWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRCQETG
  KRYWQPWSSLFFHKTPETVPQVTSKAFQHDTWNSGLTVASISTGHLTSDNRGDIGLLLGMIVFAVMLSILSLIGI
  FNRSFRTGIKRRILLLIPKWLYEDIPNMKNSNVVKMLQENSELMNNNSSEQVLYVDPMITEIKEIFIPEHKPTDY
  KKENTGPLETRDYPQNSLFDNTTVVYIPDLNTGYKPQISNFLPEGSHLSNNNEITSLTLKPPVDSLDSGNNPRLQ
  KHPNFAFSVSSVNSLSNTIFLGELSLILNQGECSSPDIQNSVEEETTMLLENDSPSETIPEQTLLPDEFVSCLGI
  VNEELPSINTYFPQNILESHFNRISLLEK

• Structural information:
  • Protein Domains: (127..21-)
    1 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (219..31-)
    2 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"-)
  • Interpro: IPR003961  IPR036116  IPR013783  
  • Prosite: PS50853
  • PDB: 5MZV
  • PDBsum: 5MZV
  • STRING: ENSP00000321345
• Other Databases: GeneCards:  IL23R  Malacards:  IL23R

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005143	interleukin-12 receptor binding	IBA	contributes to
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0019955	cytokine binding	IBA	molecular function
GO:0042019	interleukin-23 binding	IBA	contributes to
GO:0043235	receptor complex	IBA	cellular component
GO:0072536	interleukin-23 receptor complex	IBA	cellular component
GO:0004896	cytokine receptor activity	IBA	molecular function
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0043235	receptor complex	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0038155	interleukin-23-mediated signaling pathway	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005143	interleukin-12 receptor binding	IPI	contributes to
GO:0042019	interleukin-23 binding	IPI	contributes to
GO:0042020	interleukin-23 receptor activity	IDA	contributes to
GO:0002827	positive regulation of T-helper 1 type immune response	IDA	biological process
GO:0032725	positive regulation of granulocyte macrophage colony-stimulating factor production	IC	biological process
GO:0032819	positive regulation of natural killer cell proliferation	IC	biological process
GO:0034341	response to interferon-gamma	IDA	biological process
GO:0042509	regulation of tyrosine phosphorylation of STAT protein	IC	biological process
GO:0045672	positive regulation of osteoclast differentiation	IC	biological process
GO:0051135	positive regulation of NK T cell activation	IC	biological process
GO:0072536	interleukin-23 receptor complex	IDA	cellular component
GO:0042104	positive regulation of activated T cell proliferation	IC	biological process
GO:0002230	positive regulation of defense response to virus by host	IDA	biological process
GO:0010536	positive regulation of activation of Janus kinase activity	IC	biological process
GO:0032496	response to lipopolysaccharide	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IC	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032735	positive regulation of interleukin-12 production	IDA	biological process
GO:0032740	positive regulation of interleukin-17 production	IC	biological process
GO:0042102	positive regulation of T cell proliferation	IC	biological process
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IC	biological process
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IC	biological process
GO:0050829	defense response to Gram-negative bacterium	IC	biological process
GO:0002827	positive regulation of T-helper 1 type immune response	ISS	biological process
GO:0001916	positive regulation of T cell mediated cytotoxicity	ISS	biological process
GO:0002230	positive regulation of defense response to virus by host	ISS	biological process
GO:0032693	negative regulation of interleukin-10 production	IMP	biological process
GO:0032729	positive regulation of interferon-gamma production	TAS	biological process
GO:0043382	positive regulation of memory T cell differentiation	ISS	biological process
GO:2000318	positive regulation of T-helper 17 type immune response	ISS	biological process
GO:2000330	positive regulation of T-helper 17 cell lineage commitment	ISS	biological process
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04060	Cytokine-cytokine receptor interaction
hsa04630	JAK-STAT signaling pathway
hsa04659	Th17 cell differentiation
hsa05321	Inflammatory bowel disease

Diseases

Associated diseases	References
Crohn disease	KEGG:H00286
Inflammatory bowel disease	KEGG:H01227
Ulcerative colitis	KEGG:H01466
Behcet disease	KEGG:H01476
Crohn disease	KEGG:H00286
Inflammatory bowel disease	KEGG:H01227
Ulcerative colitis	KEGG:H01466
Behcet disease	KEGG:H01476
Celiac disease	PMID:18368064
Celiac disease	PMID:19175939
Sarcoidosis	PMID:21846945
Graves' disease	PMID:18073300
Sjogren's syndrome	PMID:22262980
Behcet's disease	PMID:22483685
Behcet's disease	PMID:20375120
Multiple sclerosis	PMID:18368064
systemic scleroderma	PMID:19918037
Pulmonary hypertension	PMID:19918037
Ankylosing spondylitis	PMID:19522770
Rheumatoid arthritis	PMID:18647855
Arthritis	PMID:19035472
Crohn's disease	PMID:17068223
Psoriasis	PMID:20978829
Systemic lupus erythematosus	PMID:21110900
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)