• Gene id: 149111

Gene Summary

• Gene Symbol: CNIH3   Gene   UCSC   Ensembl
• Aliases: CNIH-3
• Gene name: cornichon family AMPA receptor auxiliary protein 3
• Alternate names: protein cornichon homolog 3, cornichon homolog 3,
• Gene location: 1q42.12 (71851250: 71816297)     Exons: 15     NC_000010.11

Protein Summary

• Protein general information: Q8TBE1  
  • Name: Protein cornichon homolog 3 (CNIH 3) (Cornichon family AMPA receptor auxiliary protein 3)
  • Length: 160  
  • Mass: 18976
  • Tissue specificity: Expression is up-regulated in dorsolateral prefrontal cortex of patients with schizophrenia (postmortem brain study). {ECO
• Sequence:

  MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPVHARERLRNIERICFLLRKLVLPEYSIH
  SLFCIMFLCAQEWLTLGLNVPLLFYHFWRYFHCPADSSELAYDPPVVMNADTLSYCQKEAWCKLAFYLLSFFYYL
  YCMIYTLVSS

• Structural information:
  • Interpro: IPR003377  IPR033466  
  • Prosite: PS01340
  • STRING: ENSP00000272133
• Other Databases: GeneCards:  CNIH3  Malacards:  CNIH3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2000311	regulation of AMPA receptor activity	IDA	biological process
GO:0045211	postsynaptic membrane	ISS	cellular component
GO:0043198	dendritic shaft	ISS	cellular component
GO:0032281	AMPA glutamate receptor complex	ISS	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0048208	COPII vesicle coating	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016247	channel regulator activity	IEA	molecular function
GO:0035249	synaptic transmission, glutamatergic	IEA	biological process
GO:0032281	AMPA glutamate receptor complex	IEA	cellular component
GO:0042391	regulation of membrane potential	IEA	biological process
GO:0043198	dendritic shaft	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:2000311	regulation of AMPA receptor activity	IEA	biological process
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881