• Gene id: 1491

Gene Summary

• Gene Symbol: CTH   Gene   UCSC   Ensembl
• Gene name: cystathionine gamma-lyase
• Alternate names: cystathionine gamma-lyase, cystathionase (cystathionine gamma-lyase), cysteine desulfhydrase, cysteine-protein sulfhydrase, gamma-cystathionase, homoserine deaminase, homoserine dehydratase,
• Gene location: 1p31.1 (70411217: 70441948)     Exons: 13     NC_000001.11
• Gene summary(Entrez): This gene encodes a cytoplasmic enzyme in the trans-sulfuration pathway that converts cystathione derived from methionine into cysteine. Glutathione synthesis in the liver is dependent upon the availability of cysteine. Mutations in this gene cause cystat
• OMIM: 607657

Protein Summary

• Protein general information: P32929  
  • Name: Cystathionine gamma lyase (EC 4.4.1.1) (Cysteine protein sulfhydrase) (Gamma cystathionase)
  • Length: 405  
  • Mass: 44508
• Sequence:

  MQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAV
  AALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPE
  TKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLV
  SVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQH
  ELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLGISDTLIR
  LSVGLEDEEDLLEDLDQALKAAHPPSGSHS

• Structural information:
  • Interpro: IPR000277  IPR015424  IPR015422  IPR015421  
  • Prosite: PS00868
  • CDD: cd00614
  • PDB: 2NMP 3COG 3ELP 5EIG 5TSU 5TT2 6NBA
  • PDBsum: 2NMP 3COG 3ELP 5EIG 5TSU 5TT2 6NBA
  • STRING: ENSP00000359976
• Other Databases: GeneCards:  CTH  Malacards:  CTH

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016846	carbon-sulfur lyase activity	IBA	molecular function
GO:0019343	cysteine biosynthetic process via cystathionine	IBA	biological process
GO:0030170	pyridoxal phosphate binding	IBA	molecular function
GO:0004123	cystathionine gamma-lyase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0019346	transsulfuration	IBA	biological process
GO:0070814	hydrogen sulfide biosynthetic process	IDA	biological process
GO:0030170	pyridoxal phosphate binding	IDA	molecular function
GO:0030170	pyridoxal phosphate binding	IDA	molecular function
GO:0019344	cysteine biosynthetic process	IDA	biological process
GO:0018272	protein-pyridoxal-5-phosphate linkage via peptidyl-N6-pyridoxal phosphate-L-lysine	IDA	biological process
GO:0004123	cystathionine gamma-lyase activity	IDA	molecular function
GO:0004123	cystathionine gamma-lyase activity	IDA	molecular function
GO:0051289	protein homotetramerization	IPI	biological process
GO:0044540	L-cystine L-cysteine-lyase (deaminating)	IMP	molecular function
GO:0030968	endoplasmic reticulum unfolded protein response	TAS	biological process
GO:0044524	protein sulfhydration	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0030170	pyridoxal phosphate binding	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0019346	transsulfuration	IEA	biological process
GO:0008652	cellular amino acid biosynthetic process	IEA	biological process
GO:0016829	lyase activity	IEA	molecular function
GO:0019344	cysteine biosynthetic process	IEA	biological process
GO:0005516	calmodulin binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006534	cysteine metabolic process	TAS	biological process
GO:0044540	L-cystine L-cysteine-lyase (deaminating)	IEA	molecular function
GO:0004123	cystathionine gamma-lyase activity	IEA	molecular function
GO:0080146	L-cysteine desulfhydrase activity	IEA	molecular function
GO:0000098	sulfur amino acid catabolic process	TAS	biological process
GO:0019346	transsulfuration	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0044540	L-cystine L-cysteine-lyase (deaminating)	IEA	molecular function
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:2001234	negative regulation of apoptotic signaling pathway	IEA	biological process
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0044524	protein sulfhydration	IEA	biological process
GO:0004123	cystathionine gamma-lyase activity	IEA	molecular function
GO:0004123	cystathionine gamma-lyase activity	IDA	molecular function
GO:1904831	positive regulation of aortic smooth muscle cell differentiation	IMP	biological process
GO:0019343	cysteine biosynthetic process via cystathionine	IDA	biological process
GO:0019346	transsulfuration	IDA	biological process
GO:0070814	hydrogen sulfide biosynthetic process	TAS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0019344	cysteine biosynthetic process	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01230	Biosynthesis of amino acids
hsa00270	Cysteine and methionine metabolism
hsa00260	Glycine, serine and threonine metabolism
hsa00450	Selenocompound metabolism

Diseases

Associated diseases	References
Cystathioninuria	KEGG:H00182
Cystathioninuria	KEGG:H00182
Amino acid metabolic disorder	PMID:12574942
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)