• Gene id: 1490

Gene Summary

• Gene Symbol: CCN2   Gene   UCSC   Ensembl
• Aliases: CTGF, HCS24, IGFBP8, NOV2
• Gene name: cellular communication network factor 2
• Alternate names: CCN family member 2, IBP-8, IGF-binding protein 8, IGFBP-8, connective tissue growth factor, hypertrophic chondrocyte-specific protein 24, insulin-like growth factor-binding protein 8,
• Gene location: 6q23.2 (131951371: 131948175)     Exons: 5     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is a mitogen that is secreted by vascular endothelial cells. The encoded protein plays a role in chondrocyte proliferation and differentiation, cell adhesion in many cell types, and is related to platelet-derived growth fa
• OMIM: 121009

Protein Summary

• Protein general information: P29279  
  • Name: CCN family member 2 (Cellular communication network factor 2) (Connective tissue growth factor) (Hypertrophic chondrocyte specific protein 24) (Insulin like growth factor binding protein 8) (IBP 8) (IGF binding protein 8) (IGFBP 8)
  • Length: 349  
  • Mass: 38091
  • Tissue specificity: Expressed in bone marrow and thymic cells. Also expressed one of two Wilms tumors tested. {ECO
• Sequence:

  MTAASMGPVRVAFVVLLALCSRPAVGQNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCD
  PHKGLFCHFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPF
  PRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDN
  ASCRLEKQSRLCMVRPCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTT
  LPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA

• Structural information:
  • Protein Domains: (27..9-)
    (/note="IGFBP-N-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00653-)
    (101..16-)
    (/note="VWFC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00220-)
    (198..24-)
    (/note="TSP-type-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:P-)
  • Interpro: IPR006207  IPR006208  IPR009030  IPR000867  IPR012395   IPR017891  IPR000884  IPR036383  IPR001007  
  • Prosite: PS01185 PS01225 PS00222 PS51323 PS50092 PS01208 PS50184
  • STRING: ENSP00000356954
• Other Databases: GeneCards:  CCN2  Malacards:  CCN2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0060548	negative regulation of cell death	IBA	biological process
GO:0031012	extracellular matrix	IBA	cellular component
GO:0007165	signal transduction	IBA	biological process
GO:0008201	heparin binding	IBA	molecular function
GO:0007155	cell adhesion	IBA	biological process
GO:0005178	integrin binding	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005520	insulin-like growth factor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0071897	DNA biosynthetic process	IEA	biological process
GO:0005520	insulin-like growth factor binding	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0031012	extracellular matrix	TAS	cellular component
GO:0008544	epidermis development	TAS	biological process
GO:0009611	response to wounding	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0001968	fibronectin binding	IEA	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0010942	positive regulation of cell death	IEA	biological process
GO:0030324	lung development	IEA	biological process
GO:0032967	positive regulation of collagen biosynthetic process	IEA	biological process
GO:0034059	response to anoxia	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0043200	response to amino acid	IEA	biological process
GO:0043434	response to peptide hormone	IEA	biological process
GO:0050867	positive regulation of cell activation	IEA	biological process
GO:0060401	cytosolic calcium ion transport	IEA	biological process
GO:0060452	positive regulation of cardiac muscle contraction	IEA	biological process
GO:0070542	response to fatty acid	IEA	biological process
GO:0001502	cartilage condensation	IEA	biological process
GO:0001894	tissue homeostasis	IEA	biological process
GO:0005178	integrin binding	IEA	molecular function
GO:0008201	heparin binding	IEA	molecular function
GO:0008543	fibroblast growth factor receptor signaling pathway	IEA	biological process
GO:0010629	negative regulation of gene expression	IEA	biological process
GO:0030324	lung development	IEA	biological process
GO:0035988	chondrocyte proliferation	IEA	biological process
GO:0061448	connective tissue development	IEA	biological process
GO:0072593	reactive oxygen species metabolic process	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005801	cis-Golgi network	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005938	cell cortex	IEA	cellular component
GO:0007568	aging	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0009749	response to glucose	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0051385	response to mineralocorticoid	IEA	biological process
GO:0060548	negative regulation of cell death	IEA	biological process
GO:0070278	extracellular matrix constituent secretion	IEA	biological process
GO:0070318	positive regulation of G0 to G1 transition	IEA	biological process
GO:0001503	ossification	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007160	cell-matrix adhesion	IEA	biological process
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0016477	cell migration	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0031012	extracellular matrix	IEA	cellular component
GO:0032330	regulation of chondrocyte differentiation	IEA	biological process
GO:0045597	positive regulation of cell differentiation	IDA	biological process
GO:0051496	positive regulation of stress fiber assembly	IDA	biological process
GO:0046330	positive regulation of JNK cascade	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0062023	collagen-containing extracellular matrix	HDA	colocalizes with
GO:0005576	extracellular region	IEA	cellular component
GO:0008022	protein C-terminus binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04390	Hippo signaling pathway
hsa04371	Apelin signaling pathway

Diseases

Associated diseases	References
Ovarian cancer	PMID:19382180
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospadias	MIK: 17437852
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17437852	Hypospadias			2 (1 case, 1 control)	Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881