• Gene id: 1489

Gene Summary

• Gene Symbol: CTF1   Gene   UCSC   Ensembl
• Aliases: CT-1, CT1
• Gene name: cardiotrophin 1
• Alternate names: cardiotrophin-1, cardiophin 1,
• Gene location: 16p11.2 (102238960: 102204500)     Exons: 9     NC_000008.11
• Gene summary(Entrez): The protein encoded by this gene is a secreted cytokine that induces cardiac myocyte hypertrophy in vitro. It has been shown to bind and activate the ILST/gp130 receoptor. Two transcript variants encoding different isoforms have been found for this gene.
• OMIM: 600435

Protein Summary

• Protein general information: Q16619  
  • Name: Cardiotrophin 1 (CT 1)
  • Length: 201  
  • Mass: 21227
  • Tissue specificity: Highly expressed in heart, skeletal muscle, prostate and ovary. Lower levels in lung, kidney, pancreas, thymus, testis and small intestine. Little or no expression in brain, placenta, liver, spleen, colon or peripheral blood leukocytes
• Sequence:

  MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPA
  PSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGP
  RAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA

• Structural information:
  • Interpro: IPR009079  IPR010681  
  • DIP: 394
  • STRING: ENSP00000279804
• Other Databases: GeneCards:  CTF1  Malacards:  CTF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IDA	biological process
GO:0005125	cytokine activity	IBA	molecular function
GO:0005576	extracellular region	IBA	cellular component
GO:0007166	cell surface receptor signaling pathway	IBA	biological process
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IBA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005146	leukemia inhibitory factor receptor binding	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0007267	cell-cell signaling	TAS	biological process
GO:0007517	muscle organ development	TAS	biological process
GO:0007517	muscle organ development	TAS	biological process
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0048861	leukemia inhibitory factor signaling pathway	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0005146	leukemia inhibitory factor receptor binding	IEA	molecular function
GO:0048666	neuron development	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030182	neuron differentiation	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04630	JAK-STAT signaling pathway

Diseases

Associated diseases	References
Hypertension	PMID:15716706
Cardiomyopathy	PMID:11058912
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)