• Gene id: 148867

Gene Summary

• Gene Symbol: SLC30A7   Gene   UCSC   Ensembl
• Aliases: ZNT7, ZnT-7, ZnTL2
• Gene name: solute carrier family 30 member 7
• Alternate names: zinc transporter 7, solute carrier family 30 (zinc transporter), member 7, zinc transporter ZnT-7, zinc transporter like 2, znt-like transporter 2,
• Gene location: 1p21.2 (100896089: 100996912)     Exons: 14     NC_000001.11
• Gene summary(Entrez): Zinc functions as a cofactor for numerous enzymes, nuclear factors, and hormones and as an intra- and intercellular signal ion. Members of the zinc transporter (ZNT)/SLC30 subfamily of the cation diffusion facilitator family, such as SLC30A7, permit cellu
• OMIM: 611149

Protein Summary

• Protein general information: Q8NEW0  
  • Name: Zinc transporter 7 (ZnT 7) (Solute carrier family 30 member 7) (Znt like transporter 2)
  • Length: 376  
  • Mass: 41626
• Sequence:

  MLPLSIKDDEYKPPKFNLFGKISGWFRSILSDKTSRNLFFFLCLNLSFAFVELLYGIWSNCLGLISDSFHMFFDS
  TAILAGLAASVISKWRDNDAFSYGYVRAEVLAGFVNGLFLIFTAFFIFSEGVERALAPPDVHHERLLLVSILGFV
  VNLIGIFVFKHGGHGHSHGSGHGHSHSLFNGALDQAHGHVDHCHSHEVKHGAAHSHDHAHGHGHFHSHDGPSLKE
  TTGPSRQILQGVFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILIVVSVIPLLRESVGILMQRTPPL
  LENSLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLIVAPDADARWILSQTHNIFTQAGVRQLYVQIDFAA
  M

• Structural information:
  • Interpro: IPR002524  IPR027469  
  • STRING: ENSP00000359130
• Other Databases: GeneCards:  SLC30A7  Malacards:  SLC30A7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0006812	cation transport	IEA	biological process
GO:0008324	cation transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006829	zinc ion transport	IEA	biological process
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0032119	sequestering of zinc ion	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0006829	zinc ion transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0031982	vesicle	IDA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0098655	cation transmembrane transport	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881