• Gene id: 148823

Gene Summary

• Gene Symbol: GCSAML   Gene   UCSC   Ensembl
• Aliases: C1orf150
• Gene name: germinal center associated signaling and motility like
• Alternate names: germinal center-associated signaling and motility-like protein,
• Gene location: 1q44 (247507057: 247577689)     Exons: 10     NC_000001.11
• Gene summary(Entrez): This gene encodes a protein thought to be a signaling molecule associated with germinal centers, the sites of proliferation and differentiation of mature B lymphocytes. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Aug 2

Protein Summary

• Protein general information: Q5JQS6  
  • Name: Germinal center associated signaling and motility like protein
  • Length: 135  
  • Mass: 15712
• Sequence:

  MGNYLLRKLSCLGENQKKPKKGNPDEERKRQEMTTFERKLQDQDKKSQEVSSTSNQENENGSGSEEVCYTVINHI
  PHQRSSLSSNDDGYENIDSLTRKVRQFRERSETEYALLRTSVSRPCSCTHEHDYEVVFPH

• Structural information:
  • Interpro: IPR031364  
  • STRING: ENSP00000446460
• Other Databases: GeneCards:  GCSAML  Malacards:  GCSAML

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050855	regulation of B cell receptor signaling pathway	IEA	biological process
GO:2000401	regulation of lymphocyte migration	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881