• Gene id: 1488

Gene Summary

• Gene Symbol: CTBP2   Gene   UCSC   Ensembl
• Gene name: C-terminal binding protein 2
• Alternate names: C-terminal-binding protein 2, ribeye,
• Gene location: 10q26.13 (225882719: 225840555)     Exons: 28     NC_000001.11
• Gene summary(Entrez): This gene produces alternative transcripts encoding two distinct proteins. One protein is a transcriptional repressor, while the other isoform is a major component of specialized synapses known as synaptic ribbons. Both proteins contain a NAD+ binding dom
• OMIM: 602619

Protein Summary

• Protein general information: P56545  
  • Name: C terminal binding protein 2 (CtBP2)
  • Length: 445  
  • Mass: 48945
  • Tissue specificity: Ubiquitous. Highest levels in heart, skeletal muscle, and pancreas.
• Sequence:

  MALVDKHKVKRQRLDRICEGIRPQIMNGPLHPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHEKVLNE
  AVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTICHILNLYRRNT
  WLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQR
  VYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGAALDVHES
  EPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPESLRNCVNKEFFVTSAPWSVIDQQA
  IHPELNGATYRYPPGIVGVAPGGLPAAMEGIIPGGIPVTHNLPTVAHPSQAPSPNQPTKHGDNREHPNEQ

• Structural information:
  • Interpro: IPR006139  IPR029753  IPR006140  IPR036291  
  • Prosite: PS00671
  • PDB: 2OME 4LCJ
  • PDBsum: 2OME 4LCJ
  • DIP: 42104
  • STRING: ENSP00000311825
• Other Databases: GeneCards:  CTBP2  Malacards:  CTBP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003714	transcription corepressor activity	TAS	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	TAS	biological process
GO:0050872	white fat cell differentiation	ISS	biological process
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0017053	transcription repressor complex	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0016616	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IEA	molecular function
GO:0051287	NAD binding	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0019079	viral genome replication	TAS	biological process
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0048386	positive regulation of retinoic acid receptor signaling pathway	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0048386	positive regulation of retinoic acid receptor signaling pathway	IEA	biological process
GO:0050872	white fat cell differentiation	IEA	biological process
GO:0097470	ribbon synapse	IEA	cellular component
GO:0098831	presynaptic active zone cytoplasmic component	IEA	cellular component
GO:0098882	structural constituent of presynaptic active zone	IEA	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0099523	presynaptic cytosol	IEA	cellular component
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016081	synaptic vesicle docking	IEA	biological process
GO:0017053	transcription repressor complex	IEA	cellular component
GO:0035563	positive regulation of chromatin binding	IEA	biological process
GO:0042974	retinoic acid receptor binding	IEA	molecular function
GO:0045202	synapse	IEA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0098684	photoreceptor ribbon synapse	IEA	cellular component
GO:0098982	GABA-ergic synapse	IEA	cellular component
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0048790	maintenance of presynaptic active zone structure	IEA	biological process
GO:0044877	protein-containing complex binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04310	Wnt signaling pathway
hsa05220	Chronic myeloid leukemia
hsa04330	Notch signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq