• Gene id: 1487

Gene Summary

• Gene Symbol: CTBP1   Gene   UCSC   Ensembl
• Aliases: BARS, HADDTS
• Gene name: C-terminal binding protein 1
• Alternate names: C-terminal-binding protein 1, brefeldin A-ribosylated substrate,
• Gene location: 4p16.3 (1250354: 1211443)     Exons: 15     NC_000004.12
• Gene summary(Entrez): This gene encodes a protein that binds to the C-terminus of adenovirus E1A proteins. This phosphoprotein is a transcriptional repressor and may play a role during cellular proliferation. This protein and the product of a second closely related gene, CTBP2
• OMIM: 602618

Protein Summary

• Protein general information: Q13363  
  • Name: C terminal binding protein 1 (CtBP1) (EC 1.1.1. )
  • Length: 440  
  • Mass: 47535
  • Tissue specificity: Expressed in germinal center B-cells. {ECO
• Sequence:

  MGSSHLLNKGLPLGVRPPIMNGPLHPRPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLNEAVGALM
  YHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTLCHILNLYRRATWLHQAL
  REGTRVQSVEQIREVASGAARIRGETLGIIGLGRVGQAVALRAKAFGFNVLFYDPYLSDGVERALGLQRVSTLQD
  LLFHSDCVTLHCGLNEHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFS
  QGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHLTAATHWASMDPAVVHPELN
  GAAYRYPPGVVGVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHASDQL

• Structural information:
  • Interpro: IPR006139  IPR029753  IPR029752  IPR006140  IPR036291  
  • Prosite: PS00065 PS00671
  • PDB: 1MX3 4LCE 4U6Q 4U6S 6CDF 6CDR
  • PDBsum: 1MX3 4LCE 4U6Q 4U6S 6CDF 6CDR
  • DIP: 24245
  • STRING: ENSP00000290921
• Other Databases: GeneCards:  CTBP1  Malacards:  CTBP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050872	white fat cell differentiation	ISS	biological process
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0051287	NAD binding	ISS	molecular function
GO:0017053	transcription repressor complex	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0016616	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IEA	molecular function
GO:0051287	NAD binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0008022	protein C-terminus binding	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0019079	viral genome replication	TAS	biological process
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098982	GABA-ergic synapse	IEA	cellular component
GO:0017053	transcription repressor complex	IEA	cellular component
GO:0008134	transcription factor binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098831	presynaptic active zone cytoplasmic component	IEA	cellular component
GO:0050872	white fat cell differentiation	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0003682	chromatin binding	IEA	molecular function
GO:0003714	transcription corepressor activity	IDA	molecular function
GO:0003714	transcription corepressor activity	IDA	molecular function
GO:0019904	protein domain specific binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070491	repressing transcription factor binding	IPI	molecular function
GO:0035067	negative regulation of histone acetylation	IMP	biological process
GO:0051726	regulation of cell cycle	IMP	biological process
GO:0090241	negative regulation of histone H4 acetylation	IMP	biological process
GO:0017053	transcription repressor complex	IDA	cellular component
GO:0017053	transcription repressor complex	IDA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:0031065	positive regulation of histone deacetylation	IMP	biological process
GO:0006342	chromatin silencing	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04310	Wnt signaling pathway
hsa05220	Chronic myeloid leukemia
hsa04330	Notch signaling pathway

Diseases

Associated diseases	References
4p deletion syndrome	KEGG:H01773
4p deletion syndrome	KEGG:H01773
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq