• Gene id: 1486

Gene Summary

• Gene Symbol: CTBS   Gene   UCSC   Ensembl
• Aliases: CTB
• Gene name: chitobiase
• Alternate names: di-N-acetylchitobiase, chitobiase, di-N-acetyl-,
• Gene location: 1p22.3 (84574439: 84549610)     Exons: 7     NC_000001.11
• Gene summary(Entrez): Chitobiase is a lysosomal glycosidase involved in degradation of asparagine-linked oligosaccharides on glycoproteins (Aronson and Kuranda, 1989 [PubMed 2531691]).[supplied by OMIM, Nov 2010]
• OMIM: 600873

Protein Summary

• Protein general information: Q01459  
  • Name: Di N acetylchitobiase (EC 3.2.1. )
  • Length: 385  
  • Mass: 43760
• Sequence:

  MSRPQLRRWRLVSSPPSGVPGLALLALLALLALRLAAGTDCPCPEPELCRPIRHHPDFEVFVFDVGQKTWKSYDW
  SQITTVATFGKYDSELMCYAHSKGARVVLKGDVSLKDIIDPAFRASWIAQKLNLAKTQYMDGINIDIEQEVNCLS
  PEYDALTALVKETTDSFHREIEGSQVTFDVAWSPKNIDRRCYNYTGIADACDFLFVMSYDEQSQIWSECIAAANA
  PYNQTLTGYNDYIKMSINPKKLVMGVPWYGYDYTCLNLSEDHVCTIAKVPFRGAPCSDAAGRQVPYKTIMKQINS
  SISGNLWDKDQRAPYYNYKDPAGHFHQVWYDNPQSISLKATYIQNYRLRGIGMWNANCLDYSGDAVAKQQTEEMW
  EVLKPKLLQR

• Structural information:
  • Protein Domains: (39..38-)
    (/note="GH18-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01258"-)
  • Interpro: IPR011583  IPR029070  IPR001223  IPR001579  IPR017853  
  • Prosite: PS01095 PS51910
  • STRING: ENSP00000359664
• Other Databases: GeneCards:  CTBS  Malacards:  CTBS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006032	chitin catabolic process	IBA	biological process
GO:0004568	chitinase activity	IBA	molecular function
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0008061	chitin binding	IEA	molecular function
GO:0004553	hydrolase activity, hydrolyzing O-glycosyl compounds	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0008152	metabolic process	IEA	biological process
GO:0016798	hydrolase activity, acting on glycosyl bonds	IEA	molecular function
GO:0004568	chitinase activity	IEA	molecular function
GO:0006032	chitin catabolic process	IEA	biological process
GO:0009313	oligosaccharide catabolic process	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0005615	extracellular space	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray