• Gene id: 148362

Gene Summary

• Gene Symbol: BROX   Gene   UCSC   Ensembl
• Aliases: C1orf58
• Gene name: BRO1 domain and CAAX motif containing
• Alternate names: BRO1 domain-containing protein BROX,
• Gene location: 1q41 (222712552: 222735195)     Exons: 16     NC_000001.11

Protein Summary

• Protein general information: Q5VW32  
  • Name: BRO1 domain containing protein BROX (BRO1 domain and CAAX motif containing protein)
  • Length: 411  
  • Mass: 46476
• Sequence:

  MTHWFHRNPLKATAPVSFNYYGVVTGPSASKICNDLRSSRARLLELFTDLSCNPEMMKNAADSYFSLLQGFINSL
  DESTQESKLRYIQNFKWTDTLQGQVPSAQQDAVFELISMGFNVALWYTKYASRLAGKENITEDEAKEVHRSLKIA
  AGIFKHLKESHLPKLITPAEKGRDLESRLIEAYVIQCQAEAQEVTIARAIELKHAPGLIAALAYETANFYQKADH
  TLSSLEPAYSAKWRKYLHLKMCFYTAYAYCYHGETLLASDKCGEAIRSLQEAEKLYAKAEALCKEYGETKGPGPT
  VKPSGHLFFRKLGNLVKNTLEKCQRENGFIYFQKIPTEAPQLELKANYGLVEPIPFEFPPTSVQWTPETLAAFDL
  TKRPKDDSTKPKPEEEVKPVKEPDIKPQKDTGCYIS

• Structural information:
  • Protein Domains: (90..40-)
    (/note="BRO1-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00526"-)
  • Interpro: IPR004328  IPR038499  IPR038898  
  • Prosite: PS51180
  • PDB: 3R9M 3ULY 3UM0 3UM1 3UM2 3UM3 3ZXP
  • PDBsum: 3R9M 3ULY 3UM0 3UM1 3UM2 3UM3 3ZXP
  • DIP: 59406
  • STRING: ENSP00000343742
• Other Databases: GeneCards:  BROX  Malacards:  BROX

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray