• Gene id: 148281

Gene Summary

• Gene Symbol: SYT6   Gene   UCSC   Ensembl
• Aliases: sytVI
• Gene name: synaptotagmin 6
• Alternate names: synaptotagmin-6, synaptotagmin VI,
• Gene location: 1p13.2 (114153868: 114089291)     Exons: 10     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene belongs to the synaptotagmin family. Synaptotagmins share a common domain structure that includes a transmembrane domain and a cytoplasmic region composed of 2 C2 domains, and are involved in calcium-dependent exocytosis o
• OMIM: 600932

Protein Summary

• Protein general information: Q5T7P8  
  • Name: Synaptotagmin 6 (Synaptotagmin VI) (SytVI)
  • Length: 510  
  • Mass: 57325
• Sequence:

  MSGVWGAGGPRCQEALAVLASLCRARPPPLGLDVETCRSFELQPPERSPSAAGAGTSVSLLAVVVIVCGVALVAV
  FLFLFWKLCWMPWRNKEASSPSSANPPLEALQSPSFRGNMADKLKDPSTLGFLEAAVKISHTSPDIPAEVQMSVK
  EHIMRHTRLQRQTTEPASSTRHTSFKRHLPRQMHVSSVDYGNELPPAAEQPTSIGRIKPELYKQKSVDGEDAKSE
  ATKSCGKINFSLRYDYETETLIVRILKAFDLPAKDFCGSSDPYVKIYLLPDRKCKLQTRVHRKTLNPTFDENFHF
  PVPYEELADRKLHLSVFDFDRFSRHDMIGEVILDNLFEASDLSRETSIWKDIQYATSESVDLGEIMFSLCYLPTA
  GRLTLTVIKCRNLKAMDITGYSDPYVKVSLLCDGRRLKKKKTTIKKNTLNPVYNEAIIFDIPPENMDQVSLLISV
  MDYDRVGHNEIIGVCRVGITAEGLGRDHWNEMLAYPRKPIAHWHSLVEVKKSFKEGNPRL

• Structural information:
  • Protein Domains: (229..35-)
    (/note="C2-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041-)
    (361..49-)
    (/note="C2-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041"-)
  • Interpro: IPR000008  IPR035892  IPR001565  IPR028701  
  • Prosite: PS50004
  • STRING: ENSP00000477344
• Other Databases: GeneCards:  SYT6  Malacards:  SYT6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071277	cellular response to calcium ion	IBA	biological process
GO:0048791	calcium ion-regulated exocytosis of neurotransmitter	IBA	biological process
GO:0017158	regulation of calcium ion-dependent exocytosis	IBA	biological process
GO:0017156	calcium-ion regulated exocytosis	IBA	biological process
GO:0016192	vesicle-mediated transport	IBA	biological process
GO:0014059	regulation of dopamine secretion	IBA	biological process
GO:0005509	calcium ion binding	IBA	molecular function
GO:0001786	phosphatidylserine binding	IBA	molecular function
GO:0070382	exocytic vesicle	IBA	cellular component
GO:0030276	clathrin binding	IBA	molecular function
GO:0019905	syntaxin binding	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0000149	SNARE binding	IBA	molecular function
GO:0019898	extrinsic component of membrane	ISS	cellular component
GO:0005829	cytosol	ISS	cellular component
GO:0016021	integral component of membrane	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0007340	acrosome reaction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0048306	calcium-dependent protein binding	IEA	molecular function
GO:0042802	identical protein binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007340	acrosome reaction	IEA	biological process
GO:0099699	integral component of synaptic membrane	IEA	cellular component
GO:0099525	presynaptic dense core vesicle exocytosis	IEA	biological process
GO:0019905	syntaxin binding	IEA	molecular function
GO:0097038	perinuclear endoplasmic reticulum	IEA	cellular component
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0001786	phosphatidylserine binding	IEA	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0005544	calcium-dependent phospholipid binding	IDA	NOT|molecular function
GO:0042803	protein homodimerization activity	ISS	molecular function
GO:0019905	syntaxin binding	IDA	molecular function
GO:0030276	clathrin binding	IDA	molecular function
GO:0060478	acrosomal vesicle exocytosis	IMP	biological process
GO:0097038	perinuclear endoplasmic reticulum	ISS	cellular component
GO:0016021	integral component of membrane	ISS	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq