• Gene id: 148170

Gene Summary

• Gene Symbol: CDC42EP5   Gene   UCSC   Ensembl
• Aliases: Borg3, CEP5
• Gene name: CDC42 effector protein 5
• Alternate names: cdc42 effector protein 5, CDC42 effector protein (Rho GTPase binding) 5, binder of Rho GTPases 3,
• Gene location: 19q13.42 (54473295: 54465025)     Exons: 3     NC_000019.10
• Gene summary(Entrez): Cell division control protein 42 (CDC42), a small Rho GTPase, regulates the formation of F-actin-containing structures through its interaction with the downstream effector proteins. The protein encoded by this gene is a member of the Borg (binder of Rho G
• OMIM: 609171

Protein Summary

• Protein general information: Q6NZY7  
  • Name: Cdc42 effector protein 5 (Binder of Rho GTPases 3)
  • Length: 148  
  • Mass: 15207
• Sequence:

  MPVLKQLGPAQPKKRPDRGALSISAPLGDFRHTLHVGRGGDAFGDTSFLSRHGGGPPPEPRAPPAGAPRSPPPPA
  VPQSAAPSPADPLLSFHLDLGPSMLDAVLGVMDAARPEAAAAKPDAEPRPGTQPPQARCRPNADLELNDVIGL

• Structural information:
  • Protein Domains: (23..3-)
    (/note="CRIB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00057"-)
  • Interpro: IPR029273  IPR000095  
  • Prosite: PS50108
  • STRING: ENSP00000301200
• Other Databases: GeneCards:  CDC42EP5  Malacards:  CDC42EP5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008360	regulation of cell shape	IBA	biological process
GO:0007266	Rho protein signal transduction	IBA	biological process
GO:0031274	positive regulation of pseudopodium assembly	IBA	biological process
GO:0030838	positive regulation of actin filament polymerization	IBA	biological process
GO:0017049	GTP-Rho binding	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0005856	cytoskeleton	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0008360	regulation of cell shape	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007254	JNK cascade	IEA	biological process
GO:0007266	Rho protein signal transduction	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0012505	endomembrane system	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0031274	positive regulation of pseudopodium assembly	IDA	biological process
GO:0030838	positive regulation of actin filament polymerization	IDA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0008360	regulation of cell shape	IDA	biological process
GO:0017049	GTP-Rho binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)