• Gene id: 148022

Gene Summary

• Gene Symbol: TICAM1   Gene   UCSC   Ensembl
• Aliases: IIAE6, MyD88-3, PRVTIRB, TICAM-1, TRIF
• Gene name: toll like receptor adaptor molecule 1
• Alternate names: TIR domain-containing adapter molecule 1, TIR domain containing adaptor inducing interferon-beta, TIR domain-containing adapter protein inducing IFN-beta, proline-rich, vinculin and TIR domain-containing protein B, putative NF-kappa-B-activating protein 502H, ,
• Gene location: 19p13.3 (4831741: 4815923)     Exons: 2     NC_000023.11
• Gene summary(Entrez): This gene encodes an adaptor protein containing a Toll/interleukin-1 receptor (TIR) homology domain, which is an intracellular signaling domain that mediates protein-protein interactions between the Toll-like receptors (TLRs) and signal-transduction compo
• OMIM: 607601

Protein Summary

• Protein general information: Q8IUC6  
  • Name: TIR domain containing adapter molecule 1 (TICAM 1) (Proline rich, vinculin and TIR domain containing protein B) (Putative NF kappa B activating protein 502H) (Toll interleukin 1 receptor domain containing adapter protein inducing interferon beta) (MyD88 3
  • Length: 712  
  • Mass: 76422
  • Tissue specificity: Ubiquitously expressed but with higher levels in liver. {ECO
• Sequence:

  MACTGPSLPSAFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARISLEALKADAVARLVAR
  QWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASLRDVAYQEAVRTLSSRDDHRLGELQDEARNRCGWDIAG
  DPGSIRTLQSNLGCLPPSSALPSGTRSLPRPIDGVSDWSQGCSLRSTGSPASLASNLEISQSPTMPFLSLHRSPH
  GPSKLCDDPQASLVPEPVPGGCQEPEEMSWPPSGEIASPPELPSSPPPGLPEVAPDATSTGLPDTPAAPETSTNY
  PVECTEGSAGPQSLPLPILEPVKNPCSVKDQTPLQLSVEDTTSPNTKPCPPTPTTPETSPPPPPPPPSSTPCSAH
  LTPSSLFPSSLESSSEQKFYNFVILHARADEHIALRVREKLEALGVPDGATFCEDFQVPGRGELSCLQDAIDHSA
  FIILLLTSNFDCRLSLHQVNQAMMSNLTRQGSPDCVIPFLPLESSPAQLSSDTASLLSGLVRLDEHSQIFARKVA
  NTFKPHRLQARKAMWRKEQDTRALREQSQHLDGERMQAAALNAAYSAYLQSYLSYQAQMEQLQVAFGSHMSFGTG
  APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPG
  LQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE

• Structural information:
  • Protein Domains: (393..55-)
    (/note="TIR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00204"-)
  • Interpro: IPR025735  IPR017278  IPR035897  IPR040886  
  • Prosite: PS50104
  • PDB: 2M1X 2M63 3RC4 4BSX 4C0M 5JEL
  • PDBsum: 2M1X 2M63 3RC4 4BSX 4C0M 5JEL
  • DIP: 33490
  • STRING: ENSP00000248244
• Other Databases: GeneCards:  TICAM1  Malacards:  TICAM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1900017	positive regulation of cytokine production involved in inflammatory response	ISS	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0140052	cellular response to oxidised low-density lipoprotein particle stimulus	ISS	biological process
GO:0071222	cellular response to lipopolysaccharide	ISS	biological process
GO:0035666	TRIF-dependent toll-like receptor signaling pathway	ISS	biological process
GO:0010508	positive regulation of autophagy	ISS	biological process
GO:0035666	TRIF-dependent toll-like receptor signaling pathway	IMP	biological process
GO:0019901	protein kinase binding	IBA	molecular function
GO:0031663	lipopolysaccharide-mediated signaling pathway	IBA	biological process
GO:0032816	positive regulation of natural killer cell activation	IBA	biological process
GO:0035666	TRIF-dependent toll-like receptor signaling pathway	IBA	biological process
GO:0002735	positive regulation of myeloid dendritic cell cytokine production	IBA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0043330	response to exogenous dsRNA	IBA	biological process
GO:0045359	positive regulation of interferon-beta biosynthetic process	IBA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IBA	biological process
GO:1900017	positive regulation of cytokine production involved in inflammatory response	IBA	biological process
GO:0043330	response to exogenous dsRNA	ISS	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	ISS	biological process
GO:0002735	positive regulation of myeloid dendritic cell cytokine production	ISS	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	ISS	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0043330	response to exogenous dsRNA	IMP	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological process
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0034138	toll-like receptor 3 signaling pathway	TAS	biological process
GO:0035666	TRIF-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0035666	TRIF-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0035666	TRIF-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0002756	MyD88-independent toll-like receptor signaling pathway	TAS	biological process
GO:0002756	MyD88-independent toll-like receptor signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0034128	negative regulation of MyD88-independent toll-like receptor signaling pathway	TAS	biological process
GO:0034128	negative regulation of MyD88-independent toll-like receptor signaling pathway	TAS	biological process
GO:0070266	necroptotic process	TAS	biological process
GO:0070266	necroptotic process	TAS	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1900017	positive regulation of cytokine production involved in inflammatory response	IEA	biological process
GO:0097190	apoptotic signaling pathway	IEA	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0045359	positive regulation of interferon-beta biosynthetic process	IEA	biological process
GO:0045080	positive regulation of chemokine biosynthetic process	IEA	biological process
GO:0043330	response to exogenous dsRNA	IEA	biological process
GO:0043254	regulation of protein-containing complex assembly	IEA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0032755	positive regulation of interleukin-6 production	IEA	biological process
GO:0032092	positive regulation of protein binding	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0002756	MyD88-independent toll-like receptor signaling pathway	IEA	biological process
GO:0002735	positive regulation of myeloid dendritic cell cytokine production	IEA	biological process
GO:0140052	cellular response to oxidised low-density lipoprotein particle stimulus	IEA	biological process
GO:0050871	positive regulation of B cell activation	IEA	biological process
GO:0045429	positive regulation of nitric oxide biosynthetic process	IEA	biological process
GO:0035666	TRIF-dependent toll-like receptor signaling pathway	IEA	biological process
GO:0032816	positive regulation of natural killer cell activation	IEA	biological process
GO:0032760	positive regulation of tumor necrosis factor production	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0032481	positive regulation of type I interferon production	IEA	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	IEA	biological process
GO:0031398	positive regulation of protein ubiquitination	IEA	biological process
GO:0030890	positive regulation of B cell proliferation	IEA	biological process
GO:0010508	positive regulation of autophagy	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0002281	macrophage activation involved in immune response	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005776	autophagosome	IEA	cellular component
GO:0097342	ripoptosome	IDA	cellular component
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	HMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection
hsa05165	Human papillomavirus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04621	NOD-like receptor signaling pathway
hsa04217	Necroptosis
hsa05164	Influenza A
hsa05161	Hepatitis B
hsa05160	Hepatitis C
hsa05135	Yersinia infection
hsa04064	NF-kappa B signaling pathway
hsa04620	Toll-like receptor signaling pathway
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05142	Chagas disease
hsa05133	Pertussis
hsa04217	Necroptosis
hsa04620	Toll-like receptor signaling pathway
hsa04621	NOD-like receptor signaling pathway
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05135	Yersinia infection
hsa05133	Pertussis
hsa05164	Influenza A
hsa05161	Hepatitis B
hsa05160	Hepatitis C
hsa05168	Herpes simplex virus 1 infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa05165	Human papillomavirus infection
hsa05142	Chagas disease
hsa05165	Human papillomavirus infection
hsa05168	Herpes simplex virus 1 infection
hsa05161	Hepatitis B
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04217	Necroptosis
hsa04621	NOD-like receptor signaling pathway
hsa05160	Hepatitis C
hsa05135	Yersinia infection
hsa05142	Chagas disease
hsa04064	NF-kappa B signaling pathway
hsa05133	Pertussis
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05164	Influenza A
hsa04620	Toll-like receptor signaling pathway

Diseases

Associated diseases	References
Meningeal neoplasms	GAD: 20406964
Spermatogenesis defects	MIK: 11578878
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Role in regulation of spermatogenesis	MIK: 11578878
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
11578878	Role in regulation of spermatogenesis				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R