• Gene id: 148

Gene Summary

• Gene Symbol: ADRA1A   Gene   UCSC   Ensembl
• Aliases: ADRA1C, ADRA1L1, ALPHA1AAR
• Gene name: adrenoceptor alpha 1A
• Alternate names: alpha-1A adrenergic receptor, G protein coupled receptor, adrenergic, alpha-1A-, receptor, alpha-1A adrenoceptor, alpha-1A adrenoreceptor, alpha-1C adrenergic receptor,
• Gene location: 8p21.2 (26870993: 26738112)     Exons: 5     NC_000008.11
• Gene summary(Entrez): Alpha-1-adrenergic receptors (alpha-1-ARs) are members of the G protein-coupled receptor superfamily. They activate mitogenic responses and regulate growth and proliferation of many cells. There are 3 alpha-1-AR subtypes: alpha-1A, -1B and -1D, all of whi
• OMIM: 104221

Protein Summary

• Protein general information: P35348  
  • Name: Alpha 1A adrenergic receptor (Alpha 1A adrenoreceptor) (Alpha 1A adrenoceptor) (Alpha 1C adrenergic receptor) (Alpha adrenergic receptor 1c)
  • Length: 466  
  • Mass: 51487
  • Tissue specificity: Expressed in heart, brain, liver and prostate, but not in kidney, lung, adrenal, aorta and pituitary. Within the prostate, expressed in the apex, base, periurethral and lateral lobe. Isoform 4 is the most abundant isoform expressed in
• Sequence:

  MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLL
  TSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCV
  WALSLVISIGPLFGWRQPAPEDETICQINEEPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTD
  KSDSEQVTLRIHRKNAPAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
  FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKDMV
  RIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCTTARVRSKSFLQVCCCVGPSTPSLDKNHQVP
  TIKVHTISLSENGEEV

• Structural information:
  • Interpro: IPR002233  IPR001004  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • DIP: 33401
  • STRING: ENSP00000369960
• Other Databases: GeneCards:  ADRA1A  Malacards:  ADRA1A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0150099	neuron-glial cell signaling	ISS	biological process
GO:0071880	adenylate cyclase-activating adrenergic receptor signaling pathway	IBA	biological process
GO:0007267	cell-cell signaling	IBA	biological process
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0045907	positive regulation of vasoconstriction	IBA	biological process
GO:0043410	positive regulation of MAPK cascade	IBA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0004937	alpha1-adrenergic receptor activity	IBA	molecular function
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0001996	positive regulation of heart rate by epinephrine-norepinephrine	IBA	biological process
GO:0046982	protein heterodimerization activity	IDA	molecular function
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0031965	nuclear membrane	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0004935	adrenergic receptor activity	IEA	molecular function
GO:0006937	regulation of muscle contraction	IEA	biological process
GO:0055117	regulation of cardiac muscle contraction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004937	alpha1-adrenergic receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019229	regulation of vasoconstriction	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004937	alpha1-adrenergic receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006915	apoptotic process	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0035556	intracellular signal transduction	TAS	biological process
GO:0006939	smooth muscle contraction	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1903997	positive regulation of non-membrane spanning protein tyrosine kinase activity	IEA	biological process
GO:0150099	neuron-glial cell signaling	IEA	biological process
GO:0097195	pilomotor reflex	IEA	biological process
GO:0043410	positive regulation of MAPK cascade	IEA	biological process
GO:0035265	organ growth	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0010507	negative regulation of autophagy	IEA	biological process
GO:0007512	adult heart development	IEA	biological process
GO:0004937	alpha1-adrenergic receptor activity	IEA	molecular function
GO:0001997	positive regulation of the force of heart contraction by epinephrine-norepinephrine	IEA	biological process
GO:0001996	positive regulation of heart rate by epinephrine-norepinephrine	IEA	biological process
GO:0001994	norepinephrine-epinephrine vasoconstriction involved in regulation of systemic arterial blood pressure	IEA	biological process
GO:0099056	integral component of presynaptic membrane	IEA	cellular component
GO:0098982	GABA-ergic synapse	IEA	cellular component
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0060452	positive regulation of cardiac muscle contraction	IEA	biological process
GO:0060402	calcium ion transport into cytosol	IEA	biological process
GO:0045907	positive regulation of vasoconstriction	IEA	biological process
GO:0045760	positive regulation of action potential	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0035024	negative regulation of Rho protein signal transduction	IEA	biological process
GO:0032230	positive regulation of synaptic transmission, GABAergic	IEA	biological process
GO:0030018	Z disc	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0009725	response to hormone	IEA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004937	alpha1-adrenergic receptor activity	IEA	molecular function
GO:0003084	positive regulation of systemic arterial blood pressure	IEA	biological process
GO:0061049	cell growth involved in cardiac muscle cell development	IEA	biological process
GO:0045987	positive regulation of smooth muscle contraction	IEA	biological process
GO:0010613	positive regulation of cardiac muscle hypertrophy	IEA	biological process
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0001985	negative regulation of heart rate involved in baroreceptor response to increased systemic arterial blood pressure	IEA	biological process
GO:2000300	regulation of synaptic vesicle exocytosis	IEA	biological process
GO:0099055	integral component of postsynaptic membrane	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098691	dopaminergic synapse	IEA	cellular component
GO:0090037	positive regulation of protein kinase C signaling	IEA	biological process
GO:0060073	micturition	IEA	biological process
GO:0045987	positive regulation of smooth muscle contraction	IEA	biological process
GO:0030315	T-tubule	IEA	cellular component
GO:0010460	positive regulation of heart rate	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0007202	activation of phospholipase C activity	IEA	biological process
GO:0032230	positive regulation of synaptic transmission, GABAergic	ISS	biological process
GO:0004937	alpha1-adrenergic receptor activity	ISS	molecular function
GO:0007202	activation of phospholipase C activity	ISS	biological process
GO:0007568	aging	ISS	biological process
GO:0090037	positive regulation of protein kinase C signaling	ISS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	ISS	biological process
GO:0009725	response to hormone	ISS	biological process
GO:0035024	negative regulation of Rho protein signal transduction	ISS	biological process
GO:0042493	response to drug	ISS	biological process
GO:0045760	positive regulation of action potential	ISS	biological process
GO:0045907	positive regulation of vasoconstriction	ISS	biological process
GO:0060402	calcium ion transport into cytosol	ISS	biological process
GO:0060452	positive regulation of cardiac muscle contraction	ISS	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0005901	caveola	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0031965	nuclear membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004937	alpha1-adrenergic receptor activity	TAS	molecular function
GO:0004937	alpha1-adrenergic receptor activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04020	Calcium signaling pathway
hsa04022	cGMP-PKG signaling pathway
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04270	Vascular smooth muscle contraction
hsa04152	AMPK signaling pathway
hsa04970	Salivary secretion

Diseases

Associated diseases	References
Alzheimer's disease	PMID:114750
Hypertension	PMID:19011682
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq