• Gene id: 147920

Gene Summary

• Gene Symbol: IGFL2   Gene   UCSC   Ensembl
• Aliases: UNQ645, VPRI645
• Gene name: IGF like family member 2
• Alternate names: insulin growth factor-like family member 2,
• Gene location: 19q13.32 (82262762: 82130219)     Exons: 22     NC_000015.10
• Gene summary(Entrez): IGFL2 belongs to the insulin-like growth factor (IGF; see MIM 147440) family of signaling molecules that play critical roles in cellular energy metabolism and in growth and development, especially prenatal growth (Emtage et al., 2006 [PubMed 16890402]).[s
• OMIM: 610545

Protein Summary

• Protein general information: Q6UWQ7  
  • Name: Insulin growth factor like family member 2
  • Length: 119  
  • Mass: 13248
  • Tissue specificity: Detected in cerebellum, heart, placenta, spleen, stomach, testis and thymus. {ECO
• Sequence:

  MVPRIFAPAYVSVCLLLLCPREVIAPAGSEPWLCQPAPRCGDKIYNPLEQCCYNDAIVSLSETRQCGPPCTFWPC
  FELCCLDSFGLTNDFVVKLKVQGVNSQCHSSPISSKCESRRRFP

• Structural information:
  • Interpro: IPR032744  
• Other Databases: GeneCards:  IGFL2  Malacards:  IGFL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0005102	signaling receptor binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)