• Gene id: 147719

Gene Summary

• Gene Symbol: LYPD4   Gene   UCSC   Ensembl
• Aliases: SMR
• Gene name: LY6/PLAUR domain containing 4
• Alternate names: ly6/PLAUR domain-containing protein 4, sperm membrane receptor, testicular tissue protein Li 159,
• Gene location: 19q13.2 (41845203: 41833685)     Exons: 16     NC_000019.10

Protein Summary

• Protein general information: Q6UWN0  
  • Name: Ly6/PLAUR domain containing protein 4
  • Length: 246  
  • Mass: 26763
• Sequence:

  MGPQHLRLVQLFCLLGAISTLPRAGALLCYEATASRFRAVAFHNWKWLLMRNMVCKLQEGCEETLVFIETGTARG
  VVGFKGCSSSSSYPAQISYLVSPPGVSIASYSRVCRSYLCNNLTNLEPFVKLKASTPKSITSASCSCPTCVGEHM
  KDCLPNFVTTNSCPLAASTCYSSTLKFQAGFLNTTFLLMGCAREHNQLLADFHHIGSIKVTEVLNILEKSQIVGA
  ASSRQDPAWGVVLGLLFAFRD

• Structural information:
  • Protein Domains: (142..22-)
    (/note="UPAR/Ly6"-)
  • Interpro: IPR016054  
  • STRING: ENSP00000476510
• Other Databases: GeneCards:  LYPD4  Malacards:  LYPD4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046658	anchored component of plasma membrane	IBA	cellular component
GO:0044853	plasma membrane raft	IBA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray