• Gene id: 1474

Gene Summary

• Gene Symbol: CST6   Gene   UCSC   Ensembl
• Aliases: ECTD15
• Gene name: cystatin E/M
• Alternate names: cystatin-M, cystatin 6, cystatin M/E, cystatin-E, cysteine proteinase inhibitor,
• Gene location: 11q13.1 (66012007: 66013504)     Exons: 3     NC_000011.10
• Gene summary(Entrez): The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory
• OMIM: 611349

Protein Summary

• Protein general information: Q15828  
  • Name: Cystatin M (Cystatin 6) (Cystatin E)
  • Length: 149  
  • Mass: 16511
  • Tissue specificity: Restricted to the stratum granulosum of normal skin, the stratum granulosum/spinosum of psoriatic skin, and the secretory coils of eccrine sweat glands. Low expression levels are found in the nasal cavity. {ECO
• Sequence:

  MARSNLPLALGLALVAFCLLALPRDARARPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHII
  KAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM

• Structural information:
  • Interpro: IPR000010  IPR018073  
  • Prosite: PS00287
  • CDD: cd00042
  • PDB: 4N6L 4N6M 4N6N 4N6O 6FK0
  • PDBsum: 4N6L 4N6M 4N6N 4N6O 6FK0
  • STRING: ENSP00000311313
• Other Databases: GeneCards:  CST6  Malacards:  CST6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004869	cysteine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0004869	cysteine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0004869	cysteine-type endopeptidase inhibitor activity	TAS	molecular function
GO:0009653	anatomical structure morphogenesis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0008544	epidermis development	IEA	biological process
GO:0001533	cornified envelope	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881