• Gene id: 1473

Gene Summary

• Gene Symbol: CST5   Gene   UCSC   Ensembl
• Gene name: cystatin D
• Alternate names: cystatin-D, cystatin 5, cysteine-proteinase inhibitor,
• Gene location: 20p11.21 (52159596: 52132642)     Exons: 17     NC_000013.11
• Gene summary(Entrez): The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory
• OMIM: 123858

Protein Summary

• Protein general information: P28325  
  • Name: Cystatin D (Cystatin 5)
  • Length: 142  
  • Mass: 16080
  • Tissue specificity: Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in parotid gland but not in seminal vesicle, prostate, epididymis, testis, ovary, placenta, thyroid, gastric corpus, small intesti
• Sequence:

  MMWPMHTPLLLLTALMVAVAGSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQVMAAY
  QQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKV

• Structural information:
  • Interpro: IPR000010  IPR018073  
  • Prosite: PS00287
  • CDD: cd00042
  • PDB: 1RN7 1ROA
  • PDBsum: 1RN7 1ROA
  • STRING: ENSP00000307132
• Other Databases: GeneCards:  CST5  Malacards:  CST5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0004869	cysteine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0004869	cysteine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0004869	cysteine-type endopeptidase inhibitor activity	TAS	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0005576	extracellular region	IDA	cellular component
GO:0004869	cysteine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04970	Salivary secretion

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)