• Gene id: 1472

Gene Summary

• Gene Symbol: CST4   Gene   UCSC   Ensembl
• Gene name: cystatin S
• Alternate names: cystatin-S, cystatin 4, cystatin-SA-III, salivary acidic protein 1,
• Gene location: 20p11.21 (23689024: 23685639)     Exons: 3     NC_000020.11
• Gene summary(Entrez): The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory
• OMIM: 606672

Protein Summary

• Protein general information: P01036  
  • Name: Cystatin S (Cystatin 4) (Cystatin SA III) (Salivary acidic protein 1)
  • Length: 141  
  • Mass: 16214
  • Tissue specificity: Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in saliva, tears, urine and seminal fluid. {ECO
• Sequence:

  MARPLCTLLLLMATLAGALASSSKEENRIIPGGIYDADLNDEWVQRALHFAISEYNKATEDEYYRRPLQVLRARE
  QTFGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWEDRMSLVNSRCQEA

• Structural information:
  • Interpro: IPR000010  IPR018073  
  • Prosite: PS00287
  • CDD: cd00042
  • STRING: ENSP00000217423
• Other Databases: GeneCards:  CST4  Malacards:  CST4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0004869	cysteine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0004869	cysteine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0004869	cysteine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0001895	retina homeostasis	HEP	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0045861	negative regulation of proteolysis	IDA	biological process
GO:0004869	cysteine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04970	Salivary secretion

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq