• Gene id: 147179

Gene Summary

• Gene Symbol: WIPF2   Gene   UCSC   Ensembl
• Aliases: WICH, WIRE
• Gene name: WAS/WASL interacting protein family member 2
• Alternate names: WAS/WASL-interacting protein family member 2, WASP-binding protein, WASP-interacting protein-related protein, WIP- and CR16-homologous protein, WIP-related protein,
• Gene location: 17q21.2 (40219303: 40284135)     Exons: 9     NC_000017.11
• Gene summary(Entrez): This gene encodes a WASP interacting protein (WIP)-related protein. It has been shown that this protein has a role in the WASP-mediated organization of the actin cytoskeleton and that this protein is a potential link between the activated platelet-derived

Protein Summary

• Protein general information: Q8TF74  
  • Name: WAS/WASL interacting protein family member 2 (WASP interacting protein related protein) (WIP and CR16 homologous protein) (WIP related protein)
  • Length: 440  
  • Mass: 46289
  • Tissue specificity: Expressed mainly in brain, colon, lung and stomach (at protein level). Ubiquitously expressed, with high expression in brain, kidney, lung, and placenta. {ECO
• Sequence:

  MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGSSGGYG
  SGGAALQPKGGLFQGGVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDSSRASLPELPR
  MQRPSLPDLSRPNTTSSTGMKHSSSAPPPPPPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPP
  APPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTNESAPELPQRHNSLHRKTPGPVRGLAPPPPT
  SASPSLLSNRPPPPARDPPSRGAAPPPPPPVIRNGARDAPPPPPPYRMHGSEPPSRGKPPPPPSRTPAGPPPPPP
  PPLRNGHRDSITTVRSFLDDFESKYSFHPVEDFPAPEEYKHFQRIYPSKTNRAARGAPPLPPILR

• Structural information:
  • Protein Domains: (36..5-)
    (/note="WH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00406"-)
  • Interpro: IPR003124  
  • Prosite: PS51082
  • STRING: ENSP00000320924
• Other Databases: GeneCards:  WIPF2  Malacards:  WIPF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008360	regulation of cell shape	IBA	biological process
GO:0030048	actin filament-based movement	IBA	biological process
GO:0051015	actin filament binding	IBA	molecular function
GO:0005884	actin filament	IBA	cellular component
GO:0006897	endocytosis	IBA	biological process
GO:0051127	positive regulation of actin nucleation	IBA	biological process
GO:0051666	actin cortical patch localization	IBA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa05130	Pathogenic Escherichia coli infection
hsa05135	Yersinia infection

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray