• Gene id: 147040

Gene Summary

• Gene Symbol: KCTD11   Gene   UCSC   Ensembl
• Aliases: C17orf36, KCASH1, REN, REN/KCTD11
• Gene name: potassium channel tetramerization domain containing 11
• Alternate names: BTB/POZ domain-containing protein KCTD11, RING-type E3 ubiquitin transferase subunit KCTD11, potassium channel tetramerization domain-containing protein 11, retinoic acid, EGF, NGF induced gene protein,
• Gene location: 17p13.1 (7351888: 7354943)     Exons: 1     NC_000017.11
• OMIM: 609847

Protein Summary

• Protein general information: Q693B1  
  • Name: BTB/POZ domain containing protein KCTD11 (KCASH1 protein) (Potassium channel tetramerization domain containing protein 11) (RING type E3 ubiquitin transferase subunit KCTD11)
  • Length: 232  
  • Mass: 25887
  • Tissue specificity: Higher expression in cerebellum than in whole brain and lower expression in medulloblastoma. {ECO
• Sequence:

  MLGAMFRAGTPMPPNLNSQGGGHYFIDRDGKAFRHILNFLRLGRLDLPRGYGETALLRAEADFYQIRPLLDALRE
  LEASQGTPAPTAALLHADVDVSPRLVHFSARRGPHHYELSSVQVDTFRANLFCTDSECLGALRARFGVASGDRAE
  GSPHFHLEWAPRPVELPEVEYGRLGLQPLWTGGPGERREVVGTPSFLEEVLRVALEHGFRLDSVFPDPEDLLNSR
  SLRFVRH

• Structural information:
  • Protein Domains: (1..4-)
    (/note="BTB"-)
  • Interpro: IPR011333  IPR003131  
  • STRING: ENSP00000328352
• Other Databases: GeneCards:  KCTD11  Malacards:  KCTD11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045666	positive regulation of neuron differentiation	IBA	biological process
GO:0051260	protein homooligomerization	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0040008	regulation of growth	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq