• Gene id: 1470

Gene Summary

• Gene Symbol: CST2   Gene   UCSC   Ensembl
• Gene name: cystatin SA
• Alternate names: cystatin-SA, cystatin 2, cystatin S5, cysteine-proteinase inhibitor, salivary cysteine (thiol) protease inhibitor,
• Gene location: 20p11.21 (235504480: 235440653)     Exons: 14     NC_000001.11
• Gene summary(Entrez): The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory
• OMIM: 123856

Protein Summary

• Protein general information: P09228  
  • Name: Cystatin SA (Cystatin 2) (Cystatin S5)
  • Length: 141  
  • Mass: 16445
  • Tissue specificity: Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in submandibular gland and parotid gland. {ECO
• Sequence:

  MAWPLCTLLLLLATQAVALAWSPQEEDRIIEGGIYDADLNDERVQRALHFVISEYNKATEDEYYRRLLRVLRARE
  QIVGGVNYFFDIEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFQIYEVPWEDRMSLVNSRCQEA

• Structural information:
  • Interpro: IPR000010  IPR018073  
  • Prosite: PS00287
  • CDD: cd00042
  • STRING: ENSP00000307540
• Other Databases: GeneCards:  CST2  Malacards:  CST2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0004869	cysteine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0004869	cysteine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0004869	cysteine-type endopeptidase inhibitor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IDA	biological process
GO:0005615	extracellular space	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04970	Salivary secretion

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)