• Gene id: 147

Gene Summary

• Gene Symbol: ADRA1B   Gene   UCSC   Ensembl
• Aliases: ADRA1, ALPHA1BAR
• Gene name: adrenoceptor alpha 1B
• Alternate names: alpha-1B adrenergic receptor, adrenergic, alpha-1B-, receptor, alpha-1B adrenoceptor, alpha-1B adrenoreceptor,
• Gene location: 5q33.3 (159916481: 159989204)     Exons: 7     NC_000005.10
• Gene summary(Entrez): Alpha-1-adrenergic receptors (alpha-1-ARs) are members of the G protein-coupled receptor superfamily. They activate mitogenic responses and regulate growth and proliferation of many cells. There are 3 alpha-1-AR subtypes: alpha-1A, -1B and -1D, all of whi
• OMIM: 617060

SNPs

rs13181

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000019.10   g.45351661T>A
NC_000019.10   g.45351661T>G
NC_000019.9   g.45854919T>A
NC_000019.9   g.45854919T>G
NG_007067.2   g.23927A>T
NG_007067.2   g.23927A>C
NM_000400.4   c.2251A>T
NM_000400.4   c.2251A>C
NM_000400.3   c.2251A>T
NM_000400.3   c.2251A>C
XM_0115266  

Protein Summary

• Protein general information: P35368  
  • Name: Alpha 1B adrenergic receptor (Alpha 1B adrenoreceptor) (Alpha 1B adrenoceptor)
  • Length: 520  
  • Mass: 56836
• Sequence:

  MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAIVGNILVILSVACNRH
  LRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYS
  LQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCR
  VYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
  GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFVRILGCQCRGRGRRRR
  RRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRTLPSASPSPGYLGRGAPPPVELCAFPEWKAP
  GALLSLPAPEPPGRRGRHDSGPLFTFKLLTEPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF

• Structural information:
  • Interpro: IPR002233  IPR001115  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • DIP: 33399
  • STRING: ENSP00000306662
• Other Databases: GeneCards:  ADRA1B  Malacards:  ADRA1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0150099	neuron-glial cell signaling	ISS	biological process
GO:0001996	positive regulation of heart rate by epinephrine-norepinephrine	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0004937	alpha1-adrenergic receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0043410	positive regulation of MAPK cascade	IBA	biological process
GO:0045907	positive regulation of vasoconstriction	IBA	biological process
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0007267	cell-cell signaling	IBA	biological process
GO:0071880	adenylate cyclase-activating adrenergic receptor signaling pathway	IBA	biological process
GO:0046982	protein heterodimerization activity	IDA	molecular function
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0031965	nuclear membrane	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0004935	adrenergic receptor activity	IEA	molecular function
GO:0006937	regulation of muscle contraction	IEA	biological process
GO:0055117	regulation of cardiac muscle contraction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004937	alpha1-adrenergic receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019229	regulation of vasoconstriction	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004937	alpha1-adrenergic receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0035556	intracellular signal transduction	TAS	biological process
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005901	caveola	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0031965	nuclear membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04020	Calcium signaling pathway
hsa04022	cGMP-PKG signaling pathway
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04270	Vascular smooth muscle contraction
hsa04970	Salivary secretion

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq