• Gene id: 146909

Gene Summary

• Gene Symbol: KIF18B   Gene   UCSC   Ensembl
• Gene name: kinesin family member 18B
• Alternate names: kinesin-like protein KIF18B,
• Gene location: 17q21.31 (44947772: 44924710)     Exons: 17     NC_000017.11
• OMIM: 609848

Protein Summary

• Protein general information: Q86Y91  
  • Name: Kinesin like protein KIF18B
  • Length: 852  
  • Mass: 93011
  • Tissue specificity: Shows a prominent expression in the amygdala. {ECO
• Sequence:

  MAVEDSTLQVVVRVRPPTPRELDSQRRPVVQVVDERVLVFNPEEPDGGFPGLKWGGTHDGPKKKGKDLTFVFDRV
  FGEAATQQDVFQHTTHSVLDSFLQGYNCSVFAYGATGAGKTHTMLGREGDPGIMYLTTVELYRRLEARQQEKHFE
  VLISYQEVYNEQIHDLLEPKGPLAIREDPDKGVVVQGLSFHQPASAEQLLEILTRGNRNRTQHPTDANATSSRSH
  AIFQIFVKQQDRVPGLTQAVQVAKMSLIDLAGSERASSTHAKGERLREGANINRSLLALINVLNALADAKGRKTH
  VPYRDSKLTRLLKDSLGGNCRTVMIAAISPSSLTYEDTYNTLKYADRAKEIRLSLKSNVTSLDCHISQYATICQQ
  LQAEVAALRKKLQVYEGGGQPPPQDLPGSPKSGPPPEHQPCTPELPAGPRALQEESLGMEAQVERAMEGNSSDQE
  QSPEDEDEGPAEEVPTQMPEQNPTHALPESPRLTLQPKPVVGHFSARELDGDRSKQLALKVLCVAQRQYSLLQAA
  NLLTPDMITEFETLQQLVQEEKIEPGAEALRTSGLARGAPLAQELCSESIPVPSPLCPEPPGYTGPVTRTMARRL
  SGPLHTLGIPPGPNCTPAQGSRWPMEKKRRRPSALEADSPMAPKRGTKRQRQSFLPCLRRGSLPDTQPSQGPSTP
  KGERASSPCHSPRVCPATVIKSRVPLGPSAMQNCSTPLALPTRDLNATFDLSEEPPSKPSFHECIGWDKIPQELS
  RLDQPFIPRAPVPLFTMKGPKPTSSLPGTSACKKKRVASSSVSHGRSRIARLPSSTLKRPAGPLVLPELPLSPLC
  PSNRRNGKDLIRVGRALSAGNGVTKVS

• Structural information:
  • Protein Domains: (7..35-)
    (/note="Kinesin-motor)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00283"-)
  • Interpro: IPR027640  IPR019821  IPR001752  IPR036961  IPR027417  
  • Prosite: PS00411 PS50067
  • STRING: ENSP00000465992
• Other Databases: GeneCards:  KIF18B  Malacards:  KIF18B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0005874	microtubule	IBA	cellular component
GO:0008574	ATP-dependent microtubule motor activity, plus-end-directed	IBA	molecular function
GO:0016887	ATPase activity	IBA	molecular function
GO:0000070	mitotic sister chromatid segregation	IBA	biological process
GO:0003777	microtubule motor activity	IBA	molecular function
GO:0005871	kinesin complex	IBA	cellular component
GO:0007018	microtubule-based movement	IBA	biological process
GO:0007019	microtubule depolymerization	IBA	biological process
GO:0008017	microtubule binding	IBA	molecular function
GO:0061673	mitotic spindle astral microtubule	IBA	cellular component
GO:1990023	mitotic spindle midzone	IBA	cellular component
GO:0000278	mitotic cell cycle	IDA	biological process
GO:0051302	regulation of cell division	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003777	microtubule motor activity	IEA	molecular function
GO:0007018	microtubule-based movement	IEA	biological process
GO:0008017	microtubule binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:1990752	microtubule end	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0035371	microtubule plus-end	IDA	cellular component
GO:0000235	astral microtubule	IDA	cellular component
GO:0003774	motor activity	IDA	molecular function
GO:0007019	microtubule depolymerization	IDA	biological process
GO:0019894	kinesin binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray