• Gene id: 146861

Gene Summary

• Gene Symbol: SLC35G3   Gene   UCSC   Ensembl
• Aliases: AMAC1, TMEM21A
• Gene name: solute carrier family 35 member G3
• Alternate names: solute carrier family 35 member G3, acyl-malonyl-condensing enzyme 1, protein AMAC1, transmembrane protein 21A,
• Gene location: 17q12 (35194392: 35192519)     Exons: 1     NC_000017.11

Protein Summary

• Protein general information: Q8N808  
  • Name: Solute carrier family 35 member G3 (Acyl malonyl condensing enzyme 1) (Transmembrane protein 21A)
  • Length: 338  
  • Mass: 35381
  • Tissue specificity: Expressed in testis. {ECO
• Sequence:

  MAGSHPYFNQPDSTHPSPPSAPPSLRWYQRCQPSDATSGLLVALLGGGLPAGFVGPLSRMAYQASNLPSLELLIW
  RCLFHLPIALLLKLRGDPLLGTPDIRSRAFFCALLNILSIGCAYSAVQVVPAGNAATVRKGSSTVCSAVLTLCLE
  SQGLSGYDWCGLLGCILGLIIIVGPGLWTLQEGTTGVYTALGYVEAFLGGLALSLRLLVYRSLHFPPCLPTVAFL
  SGLVGLLGSVPGLFVLQAPVLPSDLLSWSCVGAVGILALVSFTCVGYAVTKAHPALVCAVLHSEVVVALILQYYM
  LHETVAPSDIVAAGVVLGSIAIITAQNLSCERTGRVEE

• Structural information:
  • Protein Domains: (49..17-)
    (/note="EamA-1)
    (272..32-)
    (/note="EamA-2")
  • Interpro: IPR000620  
  • STRING: ENSP00000297307
• Other Databases: GeneCards:  SLC35G3  Malacards:  SLC35G3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IBA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray