• Gene id: 146852

Gene Summary

• Gene Symbol: ODF4   Gene   UCSC   Ensembl
• Aliases: CT134, CT136, OPPO1
• Gene name: outer dense fiber of sperm tails 4
• Alternate names: outer dense fiber protein 4, cancer/testis antigen 134, cancer/testis antigen 136, hOPPO1, outer dense fiber 4, outer dense fiber of sperm tails protein 4, testis-specific protein oppo 1,
• Gene location: 17p13.1 (8339839: 8346047)     Exons: 4     NC_000017.11
• Gene summary(Entrez): This gene encodes a protein that is localized in the outer dense fibers of the tails of mature sperm. This protein is thought to have some important role in the sperm tail. Alternative splicing results in multiple transcript variants. [provided by RefSeq,
• OMIM: 610097

Protein Summary

• Protein general information: Q2M2E3  
  • Name: Outer dense fiber protein 4 (Outer dense fiber of sperm tails protein 4) (Testis specific protein oppo 1) (hOPPO1)
  • Length: 257  
  • Mass: 29233
  • Tissue specificity: Expressed in testis and sperm; especially localized to sperm tail (at protein level). {ECO
• Sequence:

  MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTLSLSSNRSLGQRQNSPLPFQWRITHS
  FRWMAQVLASELSLVAFILLLVVAFSKKWLDLSRSLFYQRWPVDVSNRIHTSAHVMSMGLLHFYKSRSCSDLENG
  KVTFIFSTLMLFPINIWIFELERNVSIPIGWSYFIGWLVLILYFTCAILCYFNHKSFWSLILSHPSGAVSCSSSF
  GSVEESPRAQTITDTPITQEGVLDPEQKDTHV

• Structural information:
  • STRING: ENSP00000331086
• Other Databases: GeneCards:  ODF4  Malacards:  ODF4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0007283	spermatogenesis	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)