• Gene id: 146850

Gene Summary

• Gene Symbol: PIK3R6   Gene   UCSC   Ensembl
• Aliases: C17orf38, HsT41028, p84 PIKAP, p87(PIKAP), p87PIKAP
• Gene name: phosphoinositide-3-kinase regulatory subunit 6
• Alternate names: phosphoinositide 3-kinase regulatory subunit 6, PI3Kgamma adapter protein of 87 kDa, p84 PI3K adapter protein, p87 phosphoinositide 3-kinase gamma (PI3Kg) adapter protein,
• Gene location: 17p13.1 (8870002: 8802721)     Exons: 23     NC_000017.11
• Gene summary(Entrez): Phosphoinositide 3-kinase gamma is a lipid kinase that produces the lipid second messenger phosphatidylinositol 3,4,5-trisphosphate. The kinase is composed of a catalytic subunit and one of several regulatory subunits, and is chiefly activated by G protei
• OMIM: 611220

Protein Summary

• Protein general information: Q5UE93  
  • Name: Phosphoinositide 3 kinase regulatory subunit 6 (Phosphoinositide 3 kinase gamma adapter protein of 87 kDa) (p84 PI3K adapter protein) (p84 PIKAP) (p87 PI3K adapter protein) (p87PIKAP)
  • Length: 754  
  • Mass: 84258
• Sequence:

  MESSDVELDLQRSVQAVLRELSTQAPALQSNQGMWRWSLHKKVERDPGKSPVLVRILLRELEKAESQDLRHVIIP
  LLHTVMYVLTKATGITEELYQRIYAFCTRLLTLPTPYCTVALDCAIRLKTEMAVPGTLYQRMVIAEQNLTNELYP
  YQERVFLFVDPELVSASVCSALLLEIEAAQAQQTPETCMRHVVSHALQAALGEACHAGALHRKLQASPRRTLEHY
  FHAVVAALEQMASEASPSREGHVERLEEIYCSLLGPAAGRCGGDLVQERPPSIPLPSPYITFHLWTGEEQLWKEL
  VLFLRPRSQLRLSADLEVLDLQGLRPDRELARVSVLSTDSGIERDLPTGADELPAPGSPEMERAGLQRKGGIKKR
  AWPLDFLMPGSWDGPPGLHRRTGRPSGDGEMLPGVSRLHTARVLVLGDDRMLGRLAQAYHRLRKRETQKFCLTPR
  LSLQLYYIPVLAPEKPAASRQPELGELATFLGRVDPWYQSNVNTLCPAIHKLAEMPPSLDTSRTVDPFILDVITY
  YIRMGTQPIYFQIYTVKIFFSDLSQDPTEDIFLIELKVKIQDSKFPKDGFSPRRRGVAEGPGAELSLCYQKALLS
  HRPREVTVSLRATGLILKAIPASDTEVSGSSHCPLPAAPVTDHTCLNVNVTEVVKSSNLAGKSFSTVTNTFRTNN
  IQIQSRDQRLLTLSLDKDDQRTFRDVVRFEVAPCPEPCSGAQKSKAPWLNLHGQQEVEAIKAKPKPLLMPINTFS
  GIVQ

• Structural information:
  • Interpro: IPR019522  
  • STRING: ENSP00000480157
• Other Databases: GeneCards:  PIK3R6  Malacards:  PIK3R6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042269	regulation of natural killer cell mediated cytotoxicity	IDA	biological process
GO:0046935	1-phosphatidylinositol-3-kinase regulator activity	IBA	molecular function
GO:0043406	positive regulation of MAP kinase activity	IBA	biological process
GO:0005942	phosphatidylinositol 3-kinase complex	IBA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0046935	1-phosphatidylinositol-3-kinase regulator activity	ISS	molecular function
GO:0043406	positive regulation of MAP kinase activity	ISS	biological process
GO:0046934	phosphatidylinositol-4,5-bisphosphate 3-kinase activity	ISS	contributes to
GO:0045766	positive regulation of angiogenesis	IMP	biological process
GO:0016020	membrane	ISS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	ISS	biological process
GO:0005944	phosphatidylinositol 3-kinase complex, class IB	ISS	cellular component
GO:0046935	1-phosphatidylinositol-3-kinase regulator activity	IEA	molecular function
GO:0005944	phosphatidylinositol 3-kinase complex, class IB	IEA	cellular component
GO:0001525	angiogenesis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006661	phosphatidylinositol biosynthetic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0030168	platelet activation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0043406	positive regulation of MAP kinase activity	IEA	biological process
GO:0045582	positive regulation of T cell differentiation	IEA	biological process
GO:0046935	1-phosphatidylinositol-3-kinase regulator activity	IEA	molecular function
GO:0005944	phosphatidylinositol 3-kinase complex, class IB	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0046934	phosphatidylinositol-4,5-bisphosphate 3-kinase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0046854	phosphatidylinositol phosphorylation	IEA	biological process
GO:0046854	phosphatidylinositol phosphorylation	IEA	biological process
GO:0043551	regulation of phosphatidylinositol 3-kinase activity	IEA	biological process
GO:0043551	regulation of phosphatidylinositol 3-kinase activity	IEA	biological process
GO:0043551	regulation of phosphatidylinositol 3-kinase activity	IEA	biological process
GO:0043551	regulation of phosphatidylinositol 3-kinase activity	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04062	Chemokine signaling pathway
hsa04022	cGMP-PKG signaling pathway
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04072	Phospholipase D signaling pathway
hsa04921	Oxytocin signaling pathway
hsa04371	Apelin signaling pathway
hsa04611	Platelet activation
hsa04725	Cholinergic synapse
hsa05145	Toxoplasmosis

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq