• Gene id: 146802

Gene Summary

• Gene Symbol: SLC47A2   Gene   UCSC   Ensembl
• Aliases: MATE2, MATE2-B, MATE2-K, MATE2K
• Gene name: solute carrier family 47 member 2
• Alternate names: multidrug and toxin extrusion protein 2, kidney-specific H(+)/organic cation antiporter, solute carrier family 47 (multidrug and toxin extrusion), member 2,
• Gene location: 17p11.2 (19719597: 19678291)     Exons: 12     NC_000017.11
• Gene summary(Entrez): This gene encodes a protein belonging to a family of transporters involved in excretion of toxic electrolytes, both endogenous and exogenous, through urine and bile. This transporter family shares homology with the bacterial MATE (multidrug and toxin extr
• OMIM: 609833

Protein Summary

• Protein general information: Q86VL8  
  • Name: Multidrug and toxin extrusion protein 2 (MATE 2) (hMATE 2) (Kidney specific H(+)/organic cation antiporter) (Solute carrier family 47 member 2)
  • Length: 602  
  • Mass: 65085
  • Tissue specificity: Isoform 3 is predominantly expressed in kidney. Isoform 6 is expressed in brain. {ECO
• Sequence:

  MDSLQDTVALDHGGCCPALSRLVPRGFGTEMWTLFALSGPLFLFQVLTFMIYIVSTVFCGHLGKVELASVTLAVA
  FVNVCGVSVGVGLSSACDTLMSQSFGSPNKKHVGVILQRGALVLLLCCLPCWALFLNTQHILLLFRQDPDVSRLT
  QDYVMIFIPGLPVIFLYNLLAKYLQNQGWLKGQEEESPFQTPGLSILHPSHSHLSRASFHLFQKITWPQVLSGVV
  GNCVNGVANYALVSVLNLGVRGSAYANIISQFAQTVFLLLYIVLKKLHLETWAGWSSQCLQDWGPFFSLAVPSML
  MICVEWWAYEIGSFLMGLLSVVDLSAQAVIYEVATVTYMIPLGLSIGVCVRVGMALGAADTVQAKRSAVSGVLSI
  VGISLVLGTLISILKNQLGHIFTNDEDVIALVSQVLPVYSVFHVFEAICCVYGGVLRGTGKQAFGAAVNAITYYI
  IGLPLGILLTFVVRMRIMGLWLGMLACVFLATAAFVAYTARLDWKLAAEEAKKHSGRQQQQRAESTATRPGPEKA
  VLSSVATGSSPGITLTTYSRSECHVDFFRTPEEAHALSAPTSRLSVKQLVIRRGAALGAASATLMVGLTVRILAT
  RH

• Structural information:
  • Interpro: IPR002528  
  • STRING: ENSP00000326671
• Other Databases: GeneCards:  SLC47A2  Malacards:  SLC47A2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022857	transmembrane transporter activity	IBA	molecular function
GO:0016020	membrane	IBA	cellular component
GO:0015297	antiporter activity	IEA	molecular function
GO:0042910	xenobiotic transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0055085	transmembrane transport	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0042908	xenobiotic transport	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)