• Gene id: 1468

Gene Summary

• Gene Symbol: SLC25A10   Gene   UCSC   Ensembl
• Aliases: DIC
• Gene name: solute carrier family 25 member 10
• Alternate names: mitochondrial dicarboxylate carrier, dicarboxylate ion carrier, solute carrier family 25 (mitochondrial carrier; dicarboxylate transporter), member 10,
• Gene location: 17q25.3 (81712235: 81721015)     Exons: 12     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of a family of proteins that translocate small metabolites across the mitochondrial membrane. The encoded protein exchanges dicarboxylates, such as malate and succinate, for phosphate, sulfate, and other small molecules, thereby
• OMIM: 153330

Protein Summary

• Protein general information: Q9UBX3  
  • Name: Mitochondrial dicarboxylate carrier (Solute carrier family 25 member 10)
  • Length: 287  
  • Mass: 31282
  • Tissue specificity: Present in high amounts in liver and kidney, and at lower levels in all the other tissues analyzed. {ECO
• Sequence:

  MAAEARVSRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALRVVRTDGILALYSGLSASLCRQMTYS
  LTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHALDGLYR
  VAREEGLRRLFSGATMASSRGALVTVGQLSCYDQAKQLVLSTGYLSDNIFTHFVASFIAGGCATFLCQPLDVLKT
  RLMNSKGEYQGVFHCAVETAKLGPLAFYKGLVPAGIRLIPHTVLTFVFLEQLRKNFGIKVPS

• Structural information:
  • Interpro: IPR002030  IPR018108  IPR023395  
  • Prosite: PS50920
  • STRING: ENSP00000461324
• Other Databases: GeneCards:  SLC25A10  Malacards:  SLC25A10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071423	malate transmembrane transport	IBA	biological process
GO:0015297	antiporter activity	IBA	molecular function
GO:0015141	succinate transmembrane transporter activity	IBA	molecular function
GO:0015140	malate transmembrane transporter activity	IBA	molecular function
GO:0015131	oxaloacetate transmembrane transporter activity	IBA	molecular function
GO:0015116	sulfate transmembrane transporter activity	IBA	molecular function
GO:0071422	succinate transmembrane transport	IBA	biological process
GO:0035435	phosphate ion transmembrane transport	IBA	biological process
GO:0015729	oxaloacetate transport	IBA	biological process
GO:0015709	thiosulfate transport	IBA	biological process
GO:0015117	thiosulfate transmembrane transporter activity	IBA	molecular function
GO:0008272	sulfate transport	IBA	biological process
GO:0006839	mitochondrial transport	IEA	biological process
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005310	dicarboxylic acid transmembrane transporter activity	TAS	molecular function
GO:0006835	dicarboxylic acid transport	TAS	biological process
GO:0006094	gluconeogenesis	TAS	biological process
GO:0005310	dicarboxylic acid transmembrane transporter activity	TAS	molecular function
GO:0005310	dicarboxylic acid transmembrane transporter activity	TAS	molecular function
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0006811	ion transport	TAS	biological process
GO:0070221	sulfide oxidation, using sulfide:quinone oxidoreductase	TAS	biological process
GO:0006094	gluconeogenesis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:1902358	sulfate transmembrane transport	IEA	biological process
GO:1902356	oxaloacetate(2-) transmembrane transport	IEA	biological process
GO:0005634	nucleus	HDA	cellular component
GO:0071423	malate transmembrane transport	IBA	biological process
GO:0015297	antiporter activity	IBA	molecular function
GO:0015141	succinate transmembrane transporter activity	IBA	molecular function
GO:0015140	malate transmembrane transporter activity	IBA	molecular function
GO:0015131	oxaloacetate transmembrane transporter activity	IBA	molecular function
GO:0015116	sulfate transmembrane transporter activity	IBA	molecular function
GO:0071422	succinate transmembrane transport	IBA	biological process
GO:0035435	phosphate ion transmembrane transport	IBA	biological process
GO:0015729	oxaloacetate transport	IBA	biological process
GO:0015709	thiosulfate transport	IBA	biological process
GO:0015117	thiosulfate transmembrane transporter activity	IBA	molecular function
GO:0008272	sulfate transport	IBA	biological process
GO:0006839	mitochondrial transport	IEA	biological process
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005310	dicarboxylic acid transmembrane transporter activity	TAS	molecular function
GO:0006835	dicarboxylic acid transport	TAS	biological process
GO:0006094	gluconeogenesis	TAS	biological process
GO:0005310	dicarboxylic acid transmembrane transporter activity	TAS	molecular function
GO:0005310	dicarboxylic acid transmembrane transporter activity	TAS	molecular function
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0006811	ion transport	TAS	biological process
GO:0070221	sulfide oxidation, using sulfide:quinone oxidoreductase	TAS	biological process
GO:0006094	gluconeogenesis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:1902358	sulfate transmembrane transport	IEA	biological process
GO:1902356	oxaloacetate(2-) transmembrane transport	IEA	biological process
GO:0005634	nucleus	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04964	Proximal tubule bicarbonate reclamation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray