• Gene id: 146760

Gene Summary

• Gene Symbol: RTN4RL1   Gene   UCSC   Ensembl
• Aliases: NGRH2, NgR3
• Gene name: reticulon 4 receptor like 1
• Alternate names: reticulon-4 receptor-like 1, Nogo-66 receptor homolog 2, Nogo-66 receptor-related protein 3, nogo receptor-like 2,
• Gene location: 17p13.3 (2025333: 1934676)     Exons: 2     NC_000017.11

Protein Summary

• Protein general information: Q86UN2  
  • Name: Reticulon 4 receptor like 1 (Nogo receptor like 2) (Nogo 66 receptor homolog 2) (Nogo 66 receptor related protein 3) (NgR3)
  • Length: 441  
  • Mass: 49065
  • Tissue specificity: Predominantly expressed in brain. Expressed at lower levels in kidney, lung, mammary gland, placenta, salivary gland, skeletal muscle and spleen. {ECO
• Sequence:

  MLRKGCCVELLLLLVAAELPLGGGCPRDCVCYPAPMTVSCQAHNFAAIPEGIPVDSERVFLQNNRIGLLQPGHFS
  PAMVTLWIYSNNITYIHPSTFEGFVHLEELDLGDNRQLRTLAPETFQGLVKLHALYLYKCGLSALPAGVFGGLHS
  LQYLYLQDNHIEYLQDDIFVDLVNLSHLFLHGNKLWSLGPGTFRGLVNLDRLLLHENQLQWVHHKAFHDLRRLTT
  LFLFNNSLSELQGECLAPLGALEFLRLNGNPWDCGCRARSLWEWLQRFRGSSSAVPCVSPGLRHGQDLKLLRAED
  FRNCTGPASPHQIKSHTLTTTDRAARKEHHSPHGPTRSKGHPHGPRPGHRKPGKNCTNPRNRNQISKAGAGKQAP
  ELPDYAPDYQHKFSFDIMPTARPKRKGKCARRTPIRAPSGVQQASSASSLGASLLAWTLGLAVTLR

• Structural information:
  • Protein Domains: (25..5-)
    (/note="LRRNT-)
    (255..30-)
    (/note="LRRCT"-)
  • Interpro: IPR000483  IPR001611  IPR003591  IPR032675  
  • Prosite: PS51450
  • STRING: ENSP00000330631
• Other Databases: GeneCards:  RTN4RL1  Malacards:  RTN4RL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031012	extracellular matrix	IBA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0035374	chondroitin sulfate binding	ISS	molecular function
GO:0048681	negative regulation of axon regeneration	ISS	biological process
GO:0008201	heparin binding	ISS	molecular function
GO:0010977	negative regulation of neuron projection development	ISS	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046658	anchored component of plasma membrane	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0048681	negative regulation of axon regeneration	IEA	biological process
GO:0035374	chondroitin sulfate binding	IEA	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0022038	corpus callosum development	IEA	biological process
GO:0010977	negative regulation of neuron projection development	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0046658	anchored component of plasma membrane	IDA	cellular component
GO:0038023	signaling receptor activity	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0031103	axon regeneration	TAS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq