• Gene id: 146722

Gene Summary

• Gene Symbol: CD300LF   Gene   UCSC   Ensembl
• Aliases: CD300f, CLM-1, CLM1, IREM-1, IREM1, IgSF13, LMIR3, NKIR
• Gene name: CD300 molecule like family member f
• Alternate names: CMRF35-like molecule 1, CD300 antigen-like family member F, NK inhibitory receptor, immune receptor expressed on myeloid cells 1, immunoglobin superfamily member 13, immunoglobulin superfamily member 13, inhibitory receptor IREM1,
• Gene location: 17q25.1 (74712999: 74694307)     Exons: 9     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the CD300 protein family. Members of this family are cell surface glycoproteins with a single IgV-like extracellular domain, and are involved in the regulation of immune response. The encoded protein is an inhibitory receptor

Protein Summary

• Protein general information: Q8TDQ1  
  • Name: CMRF35 like molecule 1 (CLM 1) (CD300 antigen like family member F) (Immune receptor expressed on myeloid cells 1) (IREM 1) (Immunoglobulin superfamily member 13) (IgSF13) (NK inhibitory receptor) (CD antigen CD300f)
  • Length: 290  
  • Mass: 32335
  • Tissue specificity: Highly expressed in spleen, peripheral blood leukocyte and monocyte, and lung. Weakly expressed in thymus, heart, brain, placenta, liver, skeletal muscle, kidney, pancreas, prostate, testis, ovary, small intestine or colon. Expressed s
• Sequence:

  MPLLTLYLLLFWLSGYSIVTQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEV
  KRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRH
  KLLKLSVLLPLIFTILLLLLVAASLLAWRMMKYQQKAAGMSPEQVLQPLEGDLCYADLTLQLAGTSPQKATTKLS
  SAQVDQVEVEYVTMASLPKEDISYASLTLGAEDQEPTYCNMGHLSSHLPGRGPEEPTEYSTISRP

• Structural information:
  • Protein Domains: (20..12-)
    (/note="Ig-like-V-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR013106  
  • Prosite: PS50835
  • PDB: 2NMS
  • PDBsum: 2NMS
  • STRING: ENSP00000462309
• Other Databases: GeneCards:  CD300LF  Malacards:  CD300LF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0097001	ceramide binding	IDA	molecular function
GO:0033004	negative regulation of mast cell activation	IDA	biological process
GO:0005136	interleukin-4 receptor binding	ISS	molecular function
GO:0035772	interleukin-13-mediated signaling pathway	ISS	biological process
GO:0001786	phosphatidylserine binding	ISS	molecular function
GO:2000427	positive regulation of apoptotic cell clearance	ISS	biological process
GO:0034125	negative regulation of MyD88-dependent toll-like receptor signaling pathway	IMP	biological process
GO:1902216	positive regulation of interleukin-4-mediated signaling pathway	ISS	biological process
GO:2000426	negative regulation of apoptotic cell clearance	ISS	biological process
GO:0035666	TRIF-dependent toll-like receptor signaling pathway	IMP	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050776	regulation of immune response	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq