• Gene id: 1465

Gene Summary

• Gene Symbol: CSRP1   Gene   UCSC   Ensembl
• Aliases: CRP, CRP1, CSRP, CYRP, D1S181E, HEL-141, HEL-S-286
• Gene name: cysteine and glycine rich protein 1
• Alternate names: cysteine and glycine-rich protein 1, LIM-domain protein, cysteine-rich protein 1, epididymis luminal protein 141, epididymis secretory protein Li 286, epididymis secretory sperm binding protein,
• Gene location: 1q32.1 (201507122: 201483529)     Exons: 8     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the cysteine-rich protein (CSRP) family. This gene family includes a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-fing
• OMIM: 123876

Protein Summary

• Protein general information: P21291  
  • Name: Cysteine and glycine rich protein 1 (Cysteine rich protein 1) (CRP) (CRP1) (Epididymis luminal protein 141) (HEL 141)
  • Length: 193  
  • Mass: 20567
• Sequence:

  MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQ
  GAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCG
  KGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE

• Structural information:
  • Protein Domains: (10..6-)
    1 (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00125-)
    (119..17-)
    2 (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00125"-)
  • Interpro: IPR001781  
  • Prosite: PS00478 PS50023
  • STRING: ENSP00000356275
• Other Databases: GeneCards:  CSRP1  Malacards:  CSRP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008307	structural constituent of muscle	IBA	molecular function
GO:0030036	actin cytoskeleton organization	IBA	biological process
GO:0042805	actinin binding	IBA	molecular function
GO:0060537	muscle tissue development	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0030018	Z disc	IBA	cellular component
GO:0045214	sarcomere organization	IBA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0008270	zinc ion binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0070527	platelet aggregation	HMP	biological process
GO:0005925	focal adhesion	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881