• Gene id: 146456

Gene Summary

• Gene Symbol: TMED6   Gene   UCSC   Ensembl
• Aliases: PRO34237, SPLL9146, p24g5
• Gene name: transmembrane p24 trafficking protein 6
• Alternate names: transmembrane emp24 domain-containing protein 6, p24 family protein gamma-5, p24gamma5, transmembrane emp24 protein transport domain containing 6,
• Gene location: 16q22.1 (145864408: 145793501)     Exons: 5     NC_000006.12

Protein Summary

• Protein general information: Q8WW62  
  • Name: Transmembrane emp24 domain containing protein 6 (p24 family protein gamma 5) (p24gamma5)
  • Length: 240  
  • Mass: 27631
• Sequence:

  MSPLLFGAGLVVLNLVTSARSQKTEPLSGSGDQPLFRGADRYDFAIMIPPGGTECFWQFAHQTGYFYFSYEVQRT
  VGMSHDRHVAATAHNPQGFLIDTSQGVRGQINFSTQETGFYQLCLSNQHNHFGSVQVYLNFGVFYEGPETDHKQK
  ERKQLNDTLDAIEDGTQKVQNNIFHMWRYYNFARMRKMADFFLIQSNYNYVNWWSTAQSLVIILSGILQLYFLKR
  LFNVPTTTDTKKPRC

• Structural information:
  • Protein Domains: (53..13-)
    (/note="GOLD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00096"-)
  • Interpro: IPR009038  IPR015720  
  • Prosite: PS50866
  • STRING: ENSP00000288025
• Other Databases: GeneCards:  TMED6  Malacards:  TMED6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0030134	COPII-coated ER to Golgi transport vesicle	IBA	cellular component
GO:0007030	Golgi organization	IBA	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IBA	biological process
GO:0006886	intracellular protein transport	IBA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)