• Gene id: 146433

Gene Summary

• Gene Symbol: IL34   Gene   UCSC   Ensembl
• Aliases: C16orf77, IL-34
• Gene name: interleukin 34
• Alternate names: interleukin-34,
• Gene location: 16q22.1 (70579894: 70660681)     Exons: 8     NC_000016.10
• Gene summary(Entrez): Interleukin-34 is a cytokine that promotes the differentiation and viability of monocytes and macrophages through the colony-stimulating factor-1 receptor (CSF1R; MIM 164770) (Lin et al., 2008 [PubMed 18467591]).[supplied by OMIM, May 2008]
• OMIM: 612081

Protein Summary

• Protein general information: Q6ZMJ4  
  • Name: Interleukin 34 (IL 34)
  • Length: 242  
  • Mass: 27482
  • Tissue specificity: Detected in the sinusoidal epithelium in the red pulp of spleen (at protein level). Predominantly expressed in spleen. Also detected in a range of other tissues including heart, brain, lung, liver, kidney, thymus, testis, ovary, small
• Sequence:

  MPRGFTWLRYLGIFLGVALGNEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPINYKISVPYEGVFRIA
  NVTRLQRAQVSERELRYLWVLVSLSATESVQDVLLEGHPSWKYLQEVETLLLNVQQGLTDVEVSPKVESVLSLLN
  APGPNLKLVRPKALLDNCFRVMELLYCSCCKQSSVLNWQDCEVPSPQSCSPEPSLQYAATQLYPPPPWSPSSPPH
  STGSVRPVRAQGEGLLP

• Structural information:
  • Interpro: IPR020415  IPR038328  
  • PDB: 4DKC 4DKD 4DKE 4DKF
  • PDBsum: 4DKC 4DKD 4DKE 4DKF
  • DIP: 50037
  • STRING: ENSP00000397863
• Other Databases: GeneCards:  IL34  Malacards:  IL34

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0120041	positive regulation of macrophage proliferation	IDA	biological process
GO:0043406	positive regulation of MAP kinase activity	IDA	biological process
GO:0010759	positive regulation of macrophage chemotaxis	IDA	biological process
GO:0061098	positive regulation of protein tyrosine kinase activity	IDA	biological process
GO:0061514	interleukin-34-mediated signaling pathway	IDA	biological process
GO:0045651	positive regulation of macrophage differentiation	IDA	biological process
GO:0045657	positive regulation of monocyte differentiation	IDA	biological process
GO:0045657	positive regulation of monocyte differentiation	IBA	biological process
GO:0045651	positive regulation of macrophage differentiation	IBA	biological process
GO:0008284	positive regulation of cell population proliferation	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0005157	macrophage colony-stimulating factor receptor binding	IBA	molecular function
GO:0005125	cytokine activity	IBA	molecular function
GO:0048714	positive regulation of oligodendrocyte differentiation	ISS	biological process
GO:0005157	macrophage colony-stimulating factor receptor binding	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0061518	microglial cell proliferation	IEA	biological process
GO:0048714	positive regulation of oligodendrocyte differentiation	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0005157	macrophage colony-stimulating factor receptor binding	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq