• Gene id: 1463

Gene Summary

• Gene Symbol: NCAN   Gene   UCSC   Ensembl
• Aliases: CSPG3
• Gene name: neurocan
• Alternate names: neurocan core protein, chondroitin sulfate proteoglycan 3 (neurocan), neurocan proteoglycan,
• Gene location: 19p13.11 (19211957: 19252232)     Exons: 15     NC_000019.10
• Gene summary(Entrez): Neurocan is a chondroitin sulfate proteoglycan thought to be involved in the modulation of cell adhesion and migration.[supplied by OMIM, Jul 2002]
• OMIM: 615519

Protein Summary

• Protein general information: O14594  
  • Name: Neurocan core protein (Chondroitin sulfate proteoglycan 3)
  • Length: 1321  
  • Mass: 143093
  • Tissue specificity: Brain.
• Sequence:

  MGAPFVWALGLLMLQMLLFVAGEQGTQDITDASERGLHMQKLGSGSVQAALAELVALPCLFTLQPRPSAARDAPR
  IKWTKVRTASGQRQDLPILVAKDNVVRVAKSWQGRVSLPSYPRRRANATLLLGPLRASDSGLYRCQVVRGIEDEQ
  DLVPLEVTGVVFHYRSARDRYALTFAEAQEACRLSSAIIAAPRHLQAAFEDGFDNCDAGWLSDRTVRYPITQSRP
  GCYGDRSSLPGVRSYGRRNPQELYDVYCFARELGGEVFYVGPARRLTLAGARAQCRRQGAALASVGQLHLAWHEG
  LDQCDPGWLADGSVRYPIQTPRRRCGGPAPGVRTVYRFANRTGFPSPAERFDAYCFRAHHPTSQHGDLETPSSGD
  EGEILSAEGPPVRELEPTLEEEEVVTPDFQEPLVSSGEEETLILEEKQESQQTLSPTPGDPMLASWPTGEVWLST
  VAPSPSDMGAGTAASSHTEVAPTDPMPRRRGRFKGLNGRYFQQQEPEPGLQGGMEASAQPPTSEAAVNQMEPPLA
  MAVTEMLGSGQSRSPWADLTNEVDMPGAGSAGGKSSPEPWLWPPTMVPPSISGHSRAPVLELEKAEGPSARPATP
  DLFWSPLEATVSAPSPAPWEAFPVATSPDLPMMAMLRGPKEWMLPHPTPISTEANRVEAHGEATATAPPSPAAET
  KVYSLPLSLTPTGQGGEAMPTTPESPRADFRETGETSPAQVNKAEHSSSSPWPSVNRNVAVGFVPTETATEPTGL
  RGIPGSESGVFDTAESPTSGLQATVDEVQDPWPSVYSKGLDASSPSAPLGSPGVFLVPKVTPNLEPWVATDEGPT
  VNPMDSTVTPAPSDASGIWEPGSQVFEEAESTTLSPQVALDTSIVTPLTTLEQGDKVGVPAMSTLGSSSSQPHPE
  PEDQVETQGTSGASVPPHQSSPLGKPAVPPGTPTAASVGESASVSSGEPTVPWDPSSTLLPVTLGIEDFELEVLA
  GSPGVESFWEEVASGEEPALPGTPMNAGAEEVHSDPCENNPCLHGGTCNANGTMYGCSCDQGFAGENCEIDIDDC
  LCSPCENGGTCIDEVNGFVCLCLPSYGGSFCEKDTEGCDRGWHKFQGHCYRYFAHRRAWEDAEKDCRRRSGHLTS
  VHSPEEHSFINSFGHENTWIGLNDRIVERDFQWTDNTGLQFENWRENQPDNFFAGGEDCVVMVAHESGRWNDVPC
  NYNLPYVCKKGTVLCGPPPAVENASLIGARKAKYNVHATVRYQCNEGFAQHHVATIRCRSNGKWDRPQIVCTKPR
  RSHRMRRHHHHHQHHHQHHHHKSRKERRKHKKHPTEDWEKDEGNFC

• Structural information:
  • Protein Domains: (38..15-)
    (/note="Ig-like-V-type)
    (160..25-)
    (/note="Link-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00323-)
    (259..35-)
    (/note="Link-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00323-)
    (1008..104-)
    (/note="EGF-like-1)
    (/ev-)
  • Interpro: IPR001304  IPR016186  IPR018378  IPR016187  IPR001881   IPR013032  IPR000742  IPR000152  IPR018097  IPR007110  IPR036179  IPR013783  IPR003599  IPR013106  IPR000538  IPR035976  IPR000436  
  • Prosite: PS00010 PS00615 PS50041 PS00022 PS01186 PS50026 PS01187 PS50835 PS01241 PS50963 PS50923
  • CDD: cd00033
  • STRING: ENSP00000252575
• Other Databases: GeneCards:  NCAN  Malacards:  NCAN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001501	skeletal system development	IBA	biological process
GO:0007417	central nervous system development	IBA	biological process
GO:0031012	extracellular matrix	IBA	cellular component
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005540	hyaluronic acid binding	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0005540	hyaluronic acid binding	IEA	molecular function
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0030206	chondroitin sulfate biosynthetic process	TAS	biological process
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0030207	chondroitin sulfate catabolic process	TAS	biological process
GO:0030208	dermatan sulfate biosynthetic process	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq