• Gene id: 1460

Gene Summary

• Gene Symbol: CSNK2B   Gene   UCSC   Ensembl
• Aliases: CK2B, CK2N, CSK2B, Ckb1, Ckb2, G5A
• Gene name: casein kinase 2 beta
• Alternate names: casein kinase II subunit beta, CK II beta, CSNK2B-LY6G5B-1072, CSNK2B-LY6G5B-1103, CSNK2B-LY6G5B-532, CSNK2B-LY6G5B-560, CSNK2B-LY6G5B-562, Casein kinase II beta subunit, alternative name: G5a, phosvitin, casein kinase 2, beta polypeptide, casein kinase I,
• Gene location: 6p21.33 (31665879: 31670069)     Exons: 7     NC_000006.12
• Gene summary(Entrez): This gene encodes the beta subunit of casein kinase II, a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta
• OMIM: 115441

Protein Summary

• Protein general information: P67870  
  • Name: Casein kinase II subunit beta (CK II beta) (Phosvitin) (Protein G5a)
  • Length: 215  
  • Mass: 24,942
• Sequence:

  MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQA
  AEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSR
  HHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR

• Structural information:
  • Interpro: IPR016149  IPR035991  IPR000704  
  • Prosite: PS01101
  • PDB: 1DS5 1JWH 1QF8 3EED 4DGL 4MD7 4MD8 4MD9 4NH1
  • PDBsum: 1DS5 1JWH 1QF8 3EED 4DGL 4MD7 4MD8 4MD9 4NH1
  • DIP: 131
  • STRING: ENSP00000365025
• Other Databases: GeneCards:  CSNK2B  Malacards:  CSNK2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003682	chromatin binding	IDA	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005956	protein kinase CK2 complex	NAS	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0008134	transcription factor binding	IPI	molecular function
GO:0008285	negative regulation of cell proliferation	TAS	biological process
GO:0010862	positive regulation of pathway-restricted SMAD protein phosphorylation	IDA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0019887	protein kinase regulator activity	NAS	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0032927	positive regulation of activin receptor signaling pathway	IMP	biological process
GO:0033211	adiponectin-activated signaling pathway	IDA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0043537	negative regulation of blood vessel endothelial cell migration	IDA	biological process
GO:0043623	cellular protein complex assembly	NAS	biological process
GO:0045859	regulation of protein kinase activity	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0051101	regulation of DNA binding	NAS	biological process
GO:0061154	endothelial tube morphogenesis	IMP	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0031519	PcG protein complex	IDA	cellular component
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0003682	chromatin binding	IDA	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005956	protein kinase CK2 complex	IEA	cellular component
GO:0005956	protein kinase CK2 complex	NAS	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0008134	transcription factor binding	IPI	molecular function
GO:0008285	negative regulation of cell proliferation	TAS	biological process
GO:0010862	positive regulation of pathway-restricted SMAD protein phosphorylation	IDA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0019887	protein kinase regulator activity	IEA	molecular function
GO:0019887	protein kinase regulator activity	NAS	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0032927	positive regulation of activin receptor signaling pathway	IMP	biological process
GO:0033211	adiponectin-activated signaling pathway	IDA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0043537	negative regulation of blood vessel endothelial cell migration	IDA	biological process
GO:0043623	cellular protein complex assembly	NAS	biological process
GO:0045859	regulation of protein kinase activity	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0051101	regulation of DNA binding	NAS	biological process
GO:0061154	endothelial tube morphogenesis	IMP	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0031519	PcG protein complex	IDA	cellular component
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0003682	chromatin binding	IDA	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005956	protein kinase CK2 complex	NAS	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0008134	transcription factor binding	IPI	molecular function
GO:0008285	negative regulation of cell proliferation	TAS	biological process
GO:0010862	positive regulation of pathway-restricted SMAD protein phosphorylation	IDA	biological process
GO:0019887	protein kinase regulator activity	NAS	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0032927	positive regulation of activin receptor signaling pathway	IMP	biological process
GO:0033211	adiponectin-activated signaling pathway	IDA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0043537	negative regulation of blood vessel endothelial cell migration	IDA	biological process
GO:0043623	cellular protein complex assembly	NAS	biological process
GO:0051101	regulation of DNA binding	NAS	biological process
GO:0061154	endothelial tube morphogenesis	IMP	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0031519	PcG protein complex	IDA	cellular component
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04137	Mitophagy - animal
hsa04520	Adherens junction
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05162	Measles

Diseases

Associated diseases	References
Arthritis	GAD: 18835879
Systemic lupus erythematosus (SLE)	GAD: 19851445
Male factor infertility	MIK: 15746197
Rheumatoid osteoarthritis	GAD: 18835879
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Germ cell development arrest, azoospermia	MIK: 31755150
Globozoospermia	MIK: 15746197
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
15746197	Globozoospermia			16 (six patients with globozoospermia, 10 fertile controls)	Male infertility	Csnk2a2 Csnk2b
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31755150	Germ cell development arrest, azoospermia				Male infertility